DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pk34A and SK 11

DIOPT Version :9

Sequence 1:NP_609603.1 Gene:Pk34A / 34705 FlyBaseID:FBgn0028410 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_568486.1 Gene:SK 11 / 832733 AraportID:AT5G26751 Length:405 Species:Arabidopsis thaliana


Alignment Length:357 Identity:139/357 - (38%)
Similarity:196/357 - (54%) Gaps:19/357 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VISTYAVGRLCSEPALVRIEVKDLIGSGSFGRVYQAHVNESEEIVAVKQTLYNPKLSQGEAEIMG 90
            :|.|...||.......:....:.::|.||||.|:||...|:.|.||:|:.|.:.:....|.:.| 
plant    51 IIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTM- 114

  Fly    91 QLKDHNNIVRLIMHSSVSLGFPSVDYVLLVMEYMPMTLLDYINYHLTVLQPAERLINVRILSYQM 155
            :|.||.|:|.| .|...|.......|:.||:||:|.|:...|. |...|.....||.|::.:||:
plant   115 RLLDHPNVVSL-KHCFFSTTEKDELYLNLVLEYVPETVHRVIK-HYNKLNQRMPLIYVKLYTYQI 177

  Fly   156 FRGLGYLH-LLGISHRDVKPENLLIDNQKMVLKLSDFGSAKLLVPQEPSISYICSRLYRAPELFA 219
            ||.|.|:| .:|:.|||:||:|||::.....:||.||||||:||..||:|||||||.||||||..
plant   178 FRALSYIHRCIGVCHRDIKPQNLLVNPHTHQVKLCDFGSAKVLVKGEPNISYICSRYYRAPELIF 242

  Fly   220 GYELYSCAVDIWSAGCVLAELLKGYPLFSSHKHDRKQLRLIVNMLGTDGLERAPEILSKCGNSLH 284
            |...|:.|:|:|||||||||||.|.|||.. :....||..|:.:|||...|   ||  ||.|..:
plant   243 GATEYTTAIDVWSAGCVLAELLLGQPLFPG-ESGVDQLVEIIKVLGTPTRE---EI--KCMNPNY 301

  Fly   285 -----PRTTRPSWNYLLNTAVPQDLCGLLNSCFIYEAAARISPMMACSHGSYDELRIMDAMALPM 344
                 |:.....|:.:.:..:|.:...|::....|....|.:.:....|..:||||..:|.   :
plant   302 TEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSAALDTLVHPFFDELRDPNAR---L 363

  Fly   345 PNGNPLPPLFDFNSLEM-GTDPKLWVNLLPIH 375
            |||..|||||:|...|: |...::...|:|.|
plant   364 PNGRFLPPLFNFKPHELKGVPLEMVAKLVPEH 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pk34ANP_609603.1 STKc_GSK3 39..334 CDD:271039 117/300 (39%)
S_TKc 45..328 CDD:214567 115/288 (40%)
SK 11NP_568486.1 STKc_GSK3 64..356 CDD:271039 117/300 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0658
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D990896at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.