DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pk34A and SK13

DIOPT Version :9

Sequence 1:NP_609603.1 Gene:Pk34A / 34705 FlyBaseID:FBgn0028410 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001329975.1 Gene:SK13 / 831316 AraportID:AT5G14640 Length:410 Species:Arabidopsis thaliana


Alignment Length:334 Identity:133/334 - (39%)
Similarity:187/334 - (55%) Gaps:19/334 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LIGSGSFGRVYQAHVNESEEIVAVKQTLYNPKLSQGEAEIMGQLKDHNNIVRLIMHSSVSLGFPS 113
            ::|.||||.|:||...|:.|.||:|:.|.:.:....|.:.| :|.||.|:|.| .|...|.....
plant    79 IVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTM-RLLDHPNVVSL-KHCFFSTTEKD 141

  Fly   114 VDYVLLVMEYMPMTLLDYINYHLTVLQPAERLINVRILSYQMFRGLGYLH-LLGISHRDVKPENL 177
            ..|:.||:||:|.|:. .::.|.:.......:|.|::.:||:.|.|.|:| .:|:.|||:||:||
plant   142 ELYLNLVLEYVPETVY-RVSKHYSRANQRMPIIYVKLYTYQICRALAYIHGGVGVCHRDIKPQNL 205

  Fly   178 LIDNQKMVLKLSDFGSAKLLVPQEPSISYICSRLYRAPELFAGYELYSCAVDIWSAGCVLAELLK 242
            |::.....:||.||||||:||..||:|||||||.||||||..|...|:..:|||||||||||||.
plant   206 LVNPHTHQVKLCDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTTTIDIWSAGCVLAELLL 270

  Fly   243 GYPLFSSHKHDRKQLRLIVNMLGTDGLERAPEILSKCGNSLH-----PRTTRPSWNYLLNTAVPQ 302
            |.|||.. :....||..|:.:|||...|   ||  ||.|..:     |:.....|:.:.:...|.
plant   271 GQPLFPG-ESGVDQLVEIIKVLGTPTRE---EI--KCMNPNYTEFKFPQIKAHPWHKIFHKRTPP 329

  Fly   303 DLCGLLNSCFIYEAAARISPMMACSHGSYDELRIMDAMALPMPNGNPLPPLFDFNSLEM-GTDPK 366
            :...|::....|....|.:.|.|..|..:||||..:..   :|||..|||||:|...|: |...:
plant   330 EAVDLVSRLLQYSPNLRSTAMEAIVHPFFDELRDPNTR---LPNGRALPPLFNFKPQELKGASLE 391

  Fly   367 LWVNLLPIH 375
            |...|:|.|
plant   392 LLSKLIPDH 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pk34ANP_609603.1 STKc_GSK3 39..334 CDD:271039 115/290 (40%)
S_TKc 45..328 CDD:214567 113/284 (40%)
SK13NP_001329975.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0658
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D990896at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.