DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pk34A and SKdZeta

DIOPT Version :9

Sequence 1:NP_609603.1 Gene:Pk34A / 34705 FlyBaseID:FBgn0028410 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_180655.1 Gene:SKdZeta / 817649 AraportID:AT2G30980 Length:412 Species:Arabidopsis thaliana


Alignment Length:357 Identity:141/357 - (39%)
Similarity:201/357 - (56%) Gaps:18/357 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VISTYAVGRLCSEPALVRIEVKDLIGSGSFGRVYQAHVNESEEIVAVKQTLYNPKLSQGEAEIMG 90
            :|||...|:.......:....:.::|:||||.|:||...|:.|.||:|:.|.:.:....|.::| 
plant    54 IISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGESVAIKKVLQDRRYKNRELQLM- 117

  Fly    91 QLKDHNNIVRLIMHSSVSLGFPSVDYVLLVMEYMPMTLLDYINYHLTVLQPAERLINVRILSYQM 155
            :|.||.|:|.| .|...|.......::.|||||:|.||...:. |.|.......:..|::.:||:
plant   118 RLMDHPNVVSL-KHCFFSTTTRDELFLNLVMEYVPETLYRVLK-HYTSSNQRMPIFYVKLYTYQI 180

  Fly   156 FRGLGYLHLL-GISHRDVKPENLLIDNQKMVLKLSDFGSAKLLVPQEPSISYICSRLYRAPELFA 219
            ||||.|:|.. |:.||||||:|||:|......||.||||||:||..|.:|||||||.||||||..
plant   181 FRGLAYIHTAPGVCHRDVKPQNLLVDPLTHQCKLCDFGSAKVLVKGEANISYICSRYYRAPELIF 245

  Fly   220 GYELYSCAVDIWSAGCVLAELLKGYPLFSSHKHDRKQLRLIVNMLGTDGLERAPEILSKCGNSLH 284
            |...|:.::|||||||||||||.|.|||.. ::...||..|:.:|||...|   ||  :|.|..:
plant   246 GATEYTSSIDIWSAGCVLAELLLGQPLFPG-ENSVDQLVEIIKVLGTPTRE---EI--RCMNPNY 304

  Fly   285 -----PRTTRPSWNYLLNTAVPQDLCGLLNSCFIYEAAARISPMMACSHGSYDELRIMDAMALPM 344
                 |:.....|:.:.:..:|.:...|.:....|..:.|.:.:.||:|..::|||..:|.   :
plant   305 TDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAHPFFNELREPNAR---L 366

  Fly   345 PNGNPLPPLFDFNSLEMGTDPKLWVNLLPIHL 376
            |||.||||||:|.....|..|:|...|:|.|:
plant   367 PNGRPLPPLFNFKQELSGASPELINRLIPEHV 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pk34ANP_609603.1 STKc_GSK3 39..334 CDD:271039 117/300 (39%)
S_TKc 45..328 CDD:214567 116/288 (40%)
SKdZetaNP_180655.1 STKc_GSK3 67..359 CDD:271039 117/300 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0658
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D990896at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.