DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pk34A and Gsk3a

DIOPT Version :9

Sequence 1:NP_609603.1 Gene:Pk34A / 34705 FlyBaseID:FBgn0028410 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001026837.1 Gene:Gsk3a / 606496 MGIID:2152453 Length:490 Species:Mus musculus


Alignment Length:359 Identity:149/359 - (41%)
Similarity:210/359 - (58%) Gaps:17/359 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SVISTYAVG-RLCSEPALVRIEVKDLIGSGSFGRVYQAHVNESEEIVAVKQTLYNPKLSQGEAEI 88
            :|::|...| ....|.|...|:|   ||:||||.||||.:.|:.|:||:|:.|.:.:....|.:|
Mouse   102 TVVATVGQGPERSQEVAYTDIKV---IGNGSFGVVYQARLAETRELVAIKKVLQDKRFKNRELQI 163

  Fly    89 MGQLKDHNNIVRL--IMHSSVSLGFPSVD-YVLLVMEYMPMTLLDYINYHLTVLQPAERLINVRI 150
            |.:| ||.|||||  ..:||   |....: |:.||:||:|.|:. .:..|.|..:....:|.:::
Mouse   164 MRKL-DHCNIVRLRYFFYSS---GEKKDELYLNLVLEYVPETVY-RVARHFTKAKLITPIIYIKV 223

  Fly   151 LSYQMFRGLGYLHLLGISHRDVKPENLLIDNQKMVLKLSDFGSAKLLVPQEPSISYICSRLYRAP 215
            ..||:||.|.|:|..|:.|||:||:|||:|....||||.||||||.||..||::||||||.||||
Mouse   224 YMYQLFRSLAYIHSQGVCHRDIKPQNLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAP 288

  Fly   216 ELFAGYELYSCAVDIWSAGCVLAELLKGYPLFSSHKHDRKQLRLIVNMLGTDGLERAPEILSKCG 280
            ||..|...|:.::|:|||||||||||.|.|:|.... ...||..|:.:|||...|:..|:.....
Mouse   289 ELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDS-GVDQLVEIIKVLGTPTREQIREMNPNYT 352

  Fly   281 NSLHPRTTRPSWNYLLNTA-VPQDLCGLLNSCFIYEAAARISPMMACSHGSYDELRIMDAMALPM 344
            ....|:.....|..:..:: .|.:...|.:|...|..::|:||:.||:|..:||||.:.|.   :
Mouse   353 EFKFPQIKAHPWTKVFKSSKTPPEAIALCSSLLEYTPSSRLSPLEACAHSFFDELRRLGAQ---L 414

  Fly   345 PNGNPLPPLFDFNSLEMGTDPKLWVNLLPIHLSS 378
            ||..||||||:|:..|:...|.|...|:|.||.|
Mouse   415 PNDRPLPPLFNFSPGELSIQPSLNAILIPPHLRS 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pk34ANP_609603.1 STKc_GSK3 39..334 CDD:271039 124/298 (42%)
S_TKc 45..328 CDD:214567 120/286 (42%)
Gsk3aNP_001026837.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..97
STKc_GSK3 114..407 CDD:271039 125/301 (42%)
Pkinase 119..404 CDD:278497 122/293 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 451..490
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I12448
eggNOG 1 0.900 - - E2759_KOG0658
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.