DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pk34A and gsk3bb

DIOPT Version :9

Sequence 1:NP_609603.1 Gene:Pk34A / 34705 FlyBaseID:FBgn0028410 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001139160.1 Gene:gsk3bb / 557882 ZFINID:ZDB-GENE-090312-2 Length:419 Species:Danio rerio


Alignment Length:362 Identity:142/362 - (39%)
Similarity:203/362 - (56%) Gaps:14/362 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SVISTYAV--GRLCSEPALVRIEVKDLIGSGSFGRVYQAHVNESEEIVAVKQTLYNPKLSQGEAE 87
            |.::|.|.  |:....|..|......:||:||||.||||.:.::.|:||:|:.|.:.:....|.:
Zfish    35 SKVTTVAATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDTGELVAIKKVLQDKRFKNRELQ 99

  Fly    88 IMGQLKDHNNIVRL--IMHSSVSLGFPSVD-YVLLVMEYMPMTLLDYINYHLTVLQPAERLINVR 149
            ||.:| ||.|||||  ..:||   |....: |:.|||:|:|..:.....::....|... ::.|:
Zfish   100 IMRKL-DHCNIVRLRYFFYSS---GDKKDEVYLNLVMDYVPENVYRVARHYSKAKQNLP-MVYVK 159

  Fly   150 ILSYQMFRGLGYLHLLGISHRDVKPENLLIDNQKMVLKLSDFGSAKLLVPQEPSISYICSRLYRA 214
            :..||:||.|.|:|..||.|||:||:|||:|.:..||||.||||||.||..||::||||||.|||
Zfish   160 LYMYQLFRSLAYIHSYGICHRDIKPQNLLLDPETAVLKLCDFGSAKQLVRGEPNVSYICSRYYRA 224

  Fly   215 PELFAGYELYSCAVDIWSAGCVLAELLKGYPLFSSHKHDRKQLRLIVNMLGTDGLERAPEILSKC 279
            |||..|...|:.::|||||||||||||.|.|:|.... ...||..|:.:|||...|:..|:....
Zfish   225 PELIFGATDYTSSIDIWSAGCVLAELLLGQPIFPGDS-GVDQLVEIIKVLGTPTREQIREMNPNY 288

  Fly   280 GNSLHPRTTRPSWNYLLNTAVPQDLCGLLNSCFIYEAAARISPMMACSHGSYDELRIMDAMALPM 344
            .....|:.....|..:.....|.:...|.:....|...||::|:.||:|..:||||..:   |.:
Zfish   289 TEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHTFFDELREPN---LKL 350

  Fly   345 PNGNPLPPLFDFNSLEMGTDPKLWVNLLPIHLSSMED 381
            |||...|.||:|.:.|:..:|.|...|:|.|..:..:
Zfish   351 PNGRERPVLFNFTTQELSNNPSLASVLIPAHAQNQAE 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pk34ANP_609603.1 STKc_GSK3 39..334 CDD:271039 121/297 (41%)
S_TKc 45..328 CDD:214567 117/285 (41%)
gsk3bbNP_001139160.1 STKc_GSK3 51..343 CDD:271039 121/297 (41%)
Pkinase 56..340 CDD:278497 118/289 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0658
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D990896at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
43.780

Return to query results.
Submit another query.