DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pk34A and Cdkl4

DIOPT Version :9

Sequence 1:NP_609603.1 Gene:Pk34A / 34705 FlyBaseID:FBgn0028410 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001028615.1 Gene:Cdkl4 / 381113 MGIID:3587025 Length:342 Species:Mus musculus


Alignment Length:236 Identity:85/236 - (36%)
Similarity:121/236 - (51%) Gaps:47/236 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 IGSGSFGRVYQAHVNESEEIVAVKQTLYNP------KLSQGEAEIMGQLKDHNNIVRLI------ 102
            ||.||:|.|::.....|.::||:|:.:.:.      |::..|..::.||| |.|:|.||      
Mouse    10 IGEGSYGVVFKCRNKSSGQVVAIKKFVESEDDRVVRKIALREIRMLKQLK-HPNLVNLIEVFRRK 73

  Fly   103 --MHSSVSLGFPSVDYVLLVMEYMPMTLLDYINYHLTVLQPAERLIN------VRILSYQMFRGL 159
              ||              ||.||...|||:.:          ||..|      ::.:.:|..:.|
Mouse    74 RKMH--------------LVFEYCDHTLLNEL----------ERNPNGVSDGVIKSVLWQTLQAL 114

  Fly   160 GYLHLLGISHRDVKPENLLIDNQKMVLKLSDFGSAKLLVPQEPSISYICSRLYRAPELFAGYELY 224
            .:.|.....||||||||:||..|.|: |:.|||.|::|:|.:....|:.:|.||||||..|...|
Mouse   115 NFCHKHNCIHRDVKPENILITKQGMI-KICDFGFARILIPGDAYTDYVATRWYRAPELLVGDTKY 178

  Fly   225 SCAVDIWSAGCVLAELLKGYPLFSSHKHDRKQLRLIVNMLG 265
            ..:||:|:.|||.||||.|.||:.. |.|..||.||:..||
Mouse   179 GSSVDVWAVGCVFAELLTGQPLWPG-KSDVDQLYLIIRTLG 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pk34ANP_609603.1 STKc_GSK3 39..334 CDD:271039 85/236 (36%)
S_TKc 45..328 CDD:214567 85/236 (36%)
Cdkl4NP_001028615.1 STKc_CDKL1_4 2..286 CDD:270837 85/236 (36%)
[NKR]KIAxRE 45..51 1/5 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 295..328
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.