DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pk34A and Cdk9

DIOPT Version :9

Sequence 1:NP_609603.1 Gene:Pk34A / 34705 FlyBaseID:FBgn0028410 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_477226.2 Gene:Cdk9 / 37586 FlyBaseID:FBgn0019949 Length:404 Species:Drosophila melanogaster


Alignment Length:339 Identity:91/339 - (26%)
Similarity:151/339 - (44%) Gaps:70/339 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 IGSGSFGRVYQAHVNE-SEEIVAVKQTLYN------PKLSQGEAEIMGQLKDHNNIVRLI----M 103
            ||.|:||.|::|...: :::.||:|:.|.:      |..:..|..|: ||..|.|:|.||    .
  Fly    56 IGQGTFGEVFKAREKKGNKKFVAMKKVLMDNEKEGFPITALREIRIL-QLLKHENVVNLIEICRT 119

  Fly   104 HSSVSLGFPSVDYVLL-VMEYMPMTLLDYINYHLTVLQPAERLINVRILSYQMFRGLGYLHLLGI 167
            .::.:.|:.|..|::. ..|:....||..:|...:       |..::.:..|:..||.|:|...|
  Fly   120 KATATNGYRSTFYLVFDFCEHDLAGLLSNMNVKFS-------LGEIKKVMQQLLNGLYYIHSNKI 177

  Fly   168 SHRDVKPENLLIDNQKMVLKLSDFGSAKLL-VPQEPSISYICSRL----YRAPELFAGYELYSCA 227
            .|||:|..|:|| .:..:|||:|||.|:.. :|:..|.:...:|:    ||.|||..|...|...
  Fly   178 LHRDMKAANVLI-TKHGILKLADFGLARAFSIPKNESKNRYTNRVVTLWYRPPELLLGDRNYGPP 241

  Fly   228 VDIWSAGCVLAELLKGYPLFSSHKHDRKQLRLIVNMLGT------DGLER--------------- 271
            ||:|.|||::||:....|:...:. :::||..|..:.|:      .|:|.               
  Fly   242 VDMWGAGCIMAEMWTRSPIMQGNT-EQQQLTFISQLCGSFTPDVWPGVEELELYKSIELPKNQKR 305

  Fly   272 ------APEILSKCG-------NSLHPR-----TTRPSWNYLLNTAVPQDLCGLLN----SCFIY 314
                  .|.:..:.|       .:|.|:     .|..:.::.....:|.||..:|:    |.|.|
  Fly   306 RVKERLRPYVKDQTGCDLLDKLLTLDPKKRIDADTALNHDFFWTDPMPSDLSKMLSQHLQSMFEY 370

  Fly   315 EAAARISPMMACSH 328
            .|..|.|..|...|
  Fly   371 LAQPRRSNQMRNYH 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pk34ANP_609603.1 STKc_GSK3 39..334 CDD:271039 91/339 (27%)
S_TKc 45..328 CDD:214567 90/337 (27%)
Cdk9NP_477226.2 STKc_CDK9 37..347 CDD:270848 79/300 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442374
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.