DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pk34A and gsk3ab

DIOPT Version :9

Sequence 1:NP_609603.1 Gene:Pk34A / 34705 FlyBaseID:FBgn0028410 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_571465.1 Gene:gsk3ab / 30664 ZFINID:ZDB-GENE-990714-3 Length:440 Species:Danio rerio


Alignment Length:333 Identity:138/333 - (41%)
Similarity:194/333 - (58%) Gaps:12/333 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LIGSGSFGRVYQAHVNESEEIVAVKQTLYNPKLSQGEAEIMGQLKDHNNIVRL--IMHSSVSLGF 111
            :||:||||.||||.:.:|:|:||:|:.|.:.:....|.:||.:| ||.|||||  ..:||   |.
Zfish    88 VIGNGSFGVVYQARLIDSQEMVAIKKVLQDKRFKNRELQIMRKL-DHCNIVRLRYFFYSS---GE 148

  Fly   112 PSVD-YVLLVMEYMPMTLLDYINYHLTVLQPAERLINVRILSYQMFRGLGYLHLLGISHRDVKPE 175
            ...: |:.||::::|.|:. .:..|....:....:|.|::..||:||.|.|:|..|:.|||:||:
Zfish   149 KKDEVYLNLVLDFVPETVY-RVARHFNKSKTTIPIIYVKVYMYQLFRSLAYIHSQGVCHRDIKPQ 212

  Fly   176 NLLIDNQKMVLKLSDFGSAKLLVPQEPSISYICSRLYRAPELFAGYELYSCAVDIWSAGCVLAEL 240
            |||:|....||||.||||||.||..||::||||||.||||||..|...|:..:||||||||||||
Zfish   213 NLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSNIDIWSAGCVLAEL 277

  Fly   241 LKGYPLFSSHKHDRKQLRLIVNMLGTDGLERAPEILSKCGNSLHPRTTRPSWNYLLNTAVPQDLC 305
            |.|.|:|.... ...||..|:.:|||...|:..|:.........|:.....|..:.....|.:..
Zfish   278 LLGQPIFPGDS-GVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFKPRTPPEAI 341

  Fly   306 GLLNSCFIYEAAARISPMMACSHGSYDELRIMDAMALPMPNGNPLPPLFDFNSLEMGTDPKLWVN 370
            .|.:....|....|:||:.||:|..:||||..:|.   :|||..||.||:|:.:|:...|:|...
Zfish   342 SLCSRLLEYTPVTRLSPLEACAHAFFDELRQPNAR---LPNGRELPQLFNFSPVELSIQPQLNSI 403

  Fly   371 LLPIHLSS 378
            |:|.|..|
Zfish   404 LIPPHARS 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pk34ANP_609603.1 STKc_GSK3 39..334 CDD:271039 119/287 (41%)
S_TKc 45..328 CDD:214567 117/281 (42%)
gsk3abNP_571465.1 STKc_GSK3 78..370 CDD:271039 119/287 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0658
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D990896at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
43.780

Return to query results.
Submit another query.