DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pk34A and Cdkl2

DIOPT Version :9

Sequence 1:NP_609603.1 Gene:Pk34A / 34705 FlyBaseID:FBgn0028410 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_006250799.1 Gene:Cdkl2 / 305242 RGDID:1309625 Length:568 Species:Rattus norvegicus


Alignment Length:358 Identity:105/358 - (29%)
Similarity:160/358 - (44%) Gaps:65/358 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LIGSGSFGRVYQAHVNESEEIVAVKQTLYN------PKLSQGEAEIMGQLKDHNNIVRLIMHSSV 107
            |:|.||:|.|.:....:|..|||:|:.|.:      .|::..|.:::.||: |.|:|.|:.....
  Rat     9 LVGEGSYGMVMKCRNKDSGRIVAIKKFLESDDDKMVKKIAMREIKLLKQLR-HENLVNLLEVCKK 72

  Fly   108 SLGFPSVDYVLLVMEYMPMTLLDYINYHLTVL--QPAERLINVRILSYQMFRGLGYLHLLGISHR 170
            ...:      .||.|::..|:||.:......|  |..::.:      :|:..|:|:.|...|.||
  Rat    73 KKRW------YLVFEFVDHTILDDLKLFPNGLDYQVVQKYL------FQIINGIGFCHSHNIIHR 125

  Fly   171 DVKPENLLIDNQKMVLKLSDFGSAK-LLVPQEPSISYICSRLYRAPELFAGYELYSCAVDIWSAG 234
            |:||||:|: :|..|:||.|||.|: |..|.|....|:.:|.||||||..|...|..|||||:.|
  Rat   126 DIKPENILV-SQSGVVKLCDFGFARTLAAPGEVYTDYVATRWYRAPELLVGDVKYGKAVDIWAIG 189

  Fly   235 CVLAELLKGYPLFSSHKHDRKQLRLIVNMLGT---------------DGLERAPEILSKCGNSLH 284
            |::.|:|.|.|||.. :.|..||..|:..||.               .|: |.|||.......|.
  Rat   190 CLVIEMLMGQPLFPG-ESDIDQLHHIMTCLGNLIPRHQELFYKNPVFAGV-RLPEIKDIEAEPLE 252

  Fly   285 PRTTRPSWNYLLNTAVPQDLCGLLNSCFIYEAAARISPMMA-CSHGSYDEL-----RIMDAMALP 343
            .|..:          :|:.:..|...|...:...|  |:.| ..|..:.::     |....:.|.
  Rat   253 SRYPK----------LPEVVISLAKKCLHIDPDKR--PLCADLLHHDFFQMDGFAERFSQELQLK 305

  Fly   344 M---PNGNPLPPLFDFNSLE----MGTDPKLWV 369
            :   ...|.||..|.....|    :|.:.|..|
  Rat   306 IEKDARNNSLPKKFQIRKKEKDDALGEERKTLV 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pk34ANP_609603.1 STKc_GSK3 39..334 CDD:271039 95/309 (31%)
S_TKc 45..328 CDD:214567 94/303 (31%)
Cdkl2XP_006250799.1 STKc_CDKL2_3 2..289 CDD:270836 95/307 (31%)
S_TKc 4..289 CDD:214567 95/307 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.