DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pk34A and GSK3B

DIOPT Version :9

Sequence 1:NP_609603.1 Gene:Pk34A / 34705 FlyBaseID:FBgn0028410 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_002084.2 Gene:GSK3B / 2932 HGNCID:4617 Length:433 Species:Homo sapiens


Alignment Length:367 Identity:141/367 - (38%)
Similarity:201/367 - (54%) Gaps:27/367 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SVISTYAVGRLCSEPALVRIEVKDLIGSGSFGRVYQAHVNESEEIVAVKQTLYNPKLSQGEAEIM 89
            :|::|...|.  ..|..|......:||:||||.||||.:.:|.|:||:|:.|.:.:....|.:||
Human    39 TVVATPGQGP--DRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIM 101

  Fly    90 GQLKDHNNIVRL--IMHSSVSLGFPSVD-YVLLVMEYMPMTLLDYINYHLTVLQPAERLINVRIL 151
            .:| ||.|||||  ..:||   |....: |:.||::|:|.|:.....::....|... :|.|::.
Human   102 RKL-DHCNIVRLRYFFYSS---GEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLP-VIYVKLY 161

  Fly   152 SYQMFRGLGYLHLLGISHRDVKPENLLIDNQKMVLKLSDFGSAKLLVPQEPSISYICSRLYRAPE 216
            .||:||.|.|:|..||.|||:||:|||:|....||||.||||||.||..||::||||||.|||||
Human   162 MYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPE 226

  Fly   217 LFAGYELYSCAVDIWSAGCVLAELLKGYPLFSSHKHDRKQLRLIVNMLGTDGLERAPEILSKCGN 281
            |..|...|:.::|:|||||||||||.|.|:|.... ...||..|:.:|||...|:..|:......
Human   227 LIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDS-GVDQLVEIIKVLGTPTREQIREMNPNYTE 290

  Fly   282 SLHPRTTRPSWN-------------YLLNTAVPQDLCGLLNSCFIYEAAARISPMMACSHGSYDE 333
            ...|:.....|.             .:.....|.:...|.:....|...||::|:.||:|..:||
Human   291 FKFPQIKAHPWTKDSSGTGHFTSGVRVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDE 355

  Fly   334 LRIMDAMALPMPNGNPLPPLFDFNSLEMGTDPKLWVNLLPIH 375
            ||..:   :.:|||...|.||:|.:.|:.::|.|...|:|.|
Human   356 LRDPN---VKLPNGRDTPALFNFTTQELSSNPPLATILIPPH 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pk34ANP_609603.1 STKc_GSK3 39..334 CDD:271039 122/310 (39%)
S_TKc 45..328 CDD:214567 118/298 (40%)
GSK3BNP_002084.2 STKc_GSK3 51..356 CDD:271039 122/310 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12443
eggNOG 1 0.900 - - E2759_KOG0658
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D990896at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.780

Return to query results.
Submit another query.