DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pk34A and GSK3A

DIOPT Version :9

Sequence 1:NP_609603.1 Gene:Pk34A / 34705 FlyBaseID:FBgn0028410 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_063937.2 Gene:GSK3A / 2931 HGNCID:4616 Length:483 Species:Homo sapiens


Alignment Length:358 Identity:148/358 - (41%)
Similarity:209/358 - (58%) Gaps:16/358 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SVISTYAVG-RLCSEPALVRIEVKDLIGSGSFGRVYQAHVNESEEIVAVKQTLYNPKLSQGEAEI 88
            :|::|...| ....|.|...|:|   ||:||||.||||.:.|:.|:||:|:.|.:.:....|.:|
Human   102 TVVATLGQGPERSQEVAYTDIKV---IGNGSFGVVYQARLAETRELVAIKKVLQDKRFKNRELQI 163

  Fly    89 MGQLKDHNNIVRL--IMHSSVSLGFPSVD-YVLLVMEYMPMTLLDYINYHLTVLQPAERLINVRI 150
            |.:| ||.|||||  ..:||   |....: |:.||:||:|.|:. .:..|.|..:....::.|::
Human   164 MRKL-DHCNIVRLRYFFYSS---GEKKDELYLNLVLEYVPETVY-RVARHFTKAKLTIPILYVKV 223

  Fly   151 LSYQMFRGLGYLHLLGISHRDVKPENLLIDNQKMVLKLSDFGSAKLLVPQEPSISYICSRLYRAP 215
            ..||:||.|.|:|..|:.|||:||:|||:|....||||.||||||.||..||::||||||.||||
Human   224 YMYQLFRSLAYIHSQGVCHRDIKPQNLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAP 288

  Fly   216 ELFAGYELYSCAVDIWSAGCVLAELLKGYPLFSSHKHDRKQLRLIVNMLGTDGLERAPEILSKCG 280
            ||..|...|:.::|:|||||||||||.|.|:|.... ...||..|:.:|||...|:..|:.....
Human   289 ELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDS-GVDQLVEIIKVLGTPTREQIREMNPNYT 352

  Fly   281 NSLHPRTTRPSWNYLLNTAVPQDLCGLLNSCFIYEAAARISPMMACSHGSYDELRIMDAMALPMP 345
            ....|:.....|..:..:..|.:...|.:|...|..::|:||:.||:|..:||||   .:...:|
Human   353 EFKFPQIKAHPWTKVFKSRTPPEAIALCSSLLEYTPSSRLSPLEACAHSFFDELR---CLGTQLP 414

  Fly   346 NGNPLPPLFDFNSLEMGTDPKLWVNLLPIHLSS 378
            |..||||||:|::.|:...|.|...|:|.||.|
Human   415 NNRPLPPLFNFSAGELSIQPSLNAILIPPHLRS 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pk34ANP_609603.1 STKc_GSK3 39..334 CDD:271039 124/297 (42%)
S_TKc 45..328 CDD:214567 120/285 (42%)
GSK3ANP_063937.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..96
STKc_GSK3 114..406 CDD:271039 125/300 (42%)
Pkinase 119..403 CDD:278497 122/292 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 449..483
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12443
eggNOG 1 0.900 - - E2759_KOG0658
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S376
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D990896at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.730

Return to query results.
Submit another query.