DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pk34A and F21F3.2

DIOPT Version :9

Sequence 1:NP_609603.1 Gene:Pk34A / 34705 FlyBaseID:FBgn0028410 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_491474.1 Gene:F21F3.2 / 172107 WormBaseID:WBGene00017672 Length:440 Species:Caenorhabditis elegans


Alignment Length:304 Identity:88/304 - (28%)
Similarity:148/304 - (48%) Gaps:47/304 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 SEPALVRIEVKDLIGSGSFGRVYQAHVNES-EEIVAVKQTLYNPKLSQGEAEIM----GQLKDHN 96
            ::..:::||...|...|.|..||:..:.|. |:.:|:|::.  |:..:...|.:    .:...|.
 Worm    16 NKKVMLKIEEVHLHSCGVFSNVYKGILREPYEKKIAIKKSW--PEKGERNFEFIFLTGRERAKHK 78

  Fly    97 NIVRLIMHSSVSLGFPSVDYVLLVMEYMPMTLLDYINYHLTVLQPAERLINVRILSYQMFRGLGY 161
            |::.:|.  :.|..:.:......|.::||.||.:.|...||.|       ::|:.::|:|.||.|
 Worm    79 NVIHMIF--AFSHSYDTKVCESYVFDFMPNTLAEVIRQKLTDL-------DIRLYTWQIFSGLKY 134

  Fly   162 LHLLGISHRDVKPENLLIDNQKMVLKLSDFGSAKLLVPQEPSISYICSRLYRAPELFAGYELYSC 226
            |....:.|||:||.|:|:|:....||:|||||||::|..:.:..|..:|.||.|||......|:.
 Worm   135 LEEHKVVHRDLKPVNILVDHDTAFLKISDFGSAKIIVKGKANNFYQVTRFYRPPELLMKAMEYNS 199

  Fly   227 AVDIWSAGCVLAELLKGYPLF----SSHKHDRKQLRLIVNMLGTDGLERAP---EILSKCGNSLH 284
            .||:|||||::||::|.:.:|    |:|     ||:|.....|      ||   :|.:..|..|.
 Worm   200 TVDVWSAGCIMAEMVKRHVVFPGRDSAH-----QLKLYCRCFG------APNEQDISAMKGEKLE 253

  Fly   285 PRTTRPSWNY--------LLNTAVPQDLCGLLNSCFIYEAAARI 320
                :..|.:        |:|...|..| ..:....:|....|:
 Worm   254 ----KEYWKFTKGFGLQRLVNDISPDQL-QFIKRILVYAPEKRL 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pk34ANP_609603.1 STKc_GSK3 39..334 CDD:271039 88/302 (29%)
S_TKc 45..328 CDD:214567 87/296 (29%)
F21F3.2NP_491474.1 STKc_GSK3 16..306 CDD:271039 88/304 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0658
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.