DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pk34A and cdk-7

DIOPT Version :9

Sequence 1:NP_609603.1 Gene:Pk34A / 34705 FlyBaseID:FBgn0028410 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001370652.1 Gene:cdk-7 / 171784 WormBaseID:WBGene00000408 Length:330 Species:Caenorhabditis elegans


Alignment Length:290 Identity:97/290 - (33%)
Similarity:144/290 - (49%) Gaps:39/290 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 IGSGSFGRVYQAHVNESEEIVAVKQTLYNPKLSQGEAEIMGQLKDHNN--------IVRLIMHSS 106
            :|.|.|..||.|...||.|.||:|      |:..|..|   :.||..|        :::.|.|.:
 Worm    11 LGEGQFANVYLAQDLESGECVAIK------KIKLGSRE---EAKDGINRTAIREIKLLKEIHHDN 66

  Fly   107 VSLGFPSV----DYVLLVMEYMPMTLLDYINYHLTVLQPAERLINVRILSYQMFRGLGYLHLLGI 167
            : :|...|    ..:.||.::|...|...|.....:|.||    :::.::.||..||.:||:..|
 Worm    67 I-IGLRDVIGHRTSIQLVFDFMDTDLEHVIKDKEIILMPA----HIKNITMQMLLGLEFLHVHWI 126

  Fly   168 SHRDVKPENLLIDNQKMVLKLSDFGSAKLLVPQEPSISY---ICSRLYRAPELFAGYELYSCAVD 229
            .|||:||.|||::....| ||:|||.|:..  ..|:.:|   :.:|.||||||..|...|...:|
 Worm   127 LHRDLKPNNLLMNKMGRV-KLTDFGLARFF--GSPNRNYTHQVVTRWYRAPELLFGARSYGVGID 188

  Fly   230 IWSAGCVLAELLKGYPLFSSHKHDRKQLRLIVNMLGTDGLERAPEILSKCGNS---LHPRTTRPS 291
            |||.||::||||...|:|.. :.|..||..|.|:||....|..|.:...  ||   :.|:|...:
 Worm   189 IWSVGCIIAELLLRNPIFPG-ESDIDQLVKIFNILGCPTPETWPNMTEM--NSYVIIKPQTEYMA 250

  Fly   292 WNYLLNTAVPQDLCGLLNSCFIYEAAARIS 321
            .||.. :|.||||..|:...:.::...|::
 Worm   251 LNYYF-SAAPQDLLDLMAGMWTFDPIKRLT 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pk34ANP_609603.1 STKc_GSK3 39..334 CDD:271039 97/290 (33%)
S_TKc 45..328 CDD:214567 97/290 (33%)
cdk-7NP_001370652.1 STKc_CDK7 4..302 CDD:270833 97/290 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.