DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pk34A and Cdk7

DIOPT Version :9

Sequence 1:NP_609603.1 Gene:Pk34A / 34705 FlyBaseID:FBgn0028410 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_038959416.1 Gene:Cdk7 / 171150 RGDID:621124 Length:346 Species:Rattus norvegicus


Alignment Length:366 Identity:111/366 - (30%)
Similarity:161/366 - (43%) Gaps:70/366 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RIEVKDLIGSGSFGRVYQAHVNESEEIVAVKQTL--YNPKLSQG-------EAEIMGQLKDHNNI 98
            |.|..|.:|.|.|..||:|....:.:|||:|:..  :..:...|       |.:::.:| .|.||
  Rat    11 RYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQEL-SHPNI 74

  Fly    99 VRLIMHSSVSLGFPSVDYVLLVMEYMPMTLLDYINYHLTVLQPAERLINVRILSYQMFRGLGYLH 163
            :.|:.      .|.....:.||.::|...|...|..:..||.|:    :::.......:||.|||
  Rat    75 IGLLD------AFGHKSNISLVFDFMETDLEVIIKDNSLVLTPS----HIKAYMLMTLQGLEYLH 129

  Fly   164 LLGISHRDVKPENLLIDNQKMVLKLSDFGSAKLLVPQEPSISY---ICSRLYRAPELFAGYELYS 225
            ...|.|||:||.|||:| :..||||:|||.||..  ..|:.:|   :.:|.||||||..|..:|.
  Rat   130 QHWILHRDLKPNNLLLD-ENGVLKLADFGLAKSF--GSPNRAYTHQVVTRWYRAPELLFGARMYG 191

  Fly   226 CAVDIWSAGCVLAELLKGYPLFSSHKHDRKQLRLIVNMLGTDGLERAPEILSKCGNSLHPRTTRP 290
            ..||:|:.||:|||||...| |.....|..||..|...|||...|:.|::   |  ||....|..
  Rat   192 VGVDMWAVGCILAELLLRVP-FLPGDSDLDQLTRIFETLGTPTEEQWPDM---C--SLPDYVTFK 250

  Fly   291 SWNYL----LNTAVPQDLCGLLNSCFIYEAAARIS---------------PMMACSHGSYDELRI 336
            |:..:    :..|...||..|:...|::....||:               |...|.         
  Rat   251 SFPGIPLQHIFIAAGDDLLELIQGLFLFNPCTRITASQALRTKYFSNRPGPTPGCQ--------- 306

  Fly   337 MDAMALPMPNGNPLPPLFDFNSLEMGTDPK----LWVNLLP 373
                 ||.|| .|:..|.:.::..|.|..|    |...:||
  Rat   307 -----LPRPN-CPVEALKEQSNPAMATKRKRAEALEQGILP 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pk34ANP_609603.1 STKc_GSK3 39..334 CDD:271039 99/321 (31%)
S_TKc 45..328 CDD:214567 98/313 (31%)
Cdk7XP_038959416.1 STKc_CDK7 11..308 CDD:270833 99/330 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.