DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pk34A and gsk3a

DIOPT Version :9

Sequence 1:NP_609603.1 Gene:Pk34A / 34705 FlyBaseID:FBgn0028410 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_002936450.1 Gene:gsk3a / 100144645 XenbaseID:XB-GENE-487251 Length:424 Species:Xenopus tropicalis


Alignment Length:333 Identity:136/333 - (40%)
Similarity:191/333 - (57%) Gaps:12/333 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LIGSGSFGRVYQAHVNESEEIVAVKQTLYNPKLSQGEAEIMGQLKDHNNIVRL--IMHSSVSLGF 111
            :||:||||.||||.:....|:||:|:.|.:.:....|.:||.:| ||.|||||  ..:||   |.
 Frog    76 VIGNGSFGVVYQARLVGCGEMVAIKKVLQDKRFKNRELQIMRRL-DHCNIVRLRYFFYSS---GE 136

  Fly   112 PSVD-YVLLVMEYMPMTLLDYINYHLTVLQPAERLINVRILSYQMFRGLGYLHLLGISHRDVKPE 175
            ...: |:.||::::|.|:. .:..|....:.:...|.|::..||:||.|.|:|..|:.|||:||:
 Frog   137 KKDEVYLNLVLDFVPETVY-RVARHFAKAKTSLPSIYVKVYMYQLFRSLAYIHSQGVCHRDIKPQ 200

  Fly   176 NLLIDNQKMVLKLSDFGSAKLLVPQEPSISYICSRLYRAPELFAGYELYSCAVDIWSAGCVLAEL 240
            |||:|....||||.||||||.||..||::||||||.||||||..|...|:..:||||||||||||
 Frog   201 NLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTANIDIWSAGCVLAEL 265

  Fly   241 LKGYPLFSSHKHDRKQLRLIVNMLGTDGLERAPEILSKCGNSLHPRTTRPSWNYLLNTAVPQDLC 305
            |.|.|:|.... ...||..|:.:|||...|:..|:.........|:.....|..:.......:..
 Frog   266 LLGQPIFPGDS-GVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFKPRTCPEAI 329

  Fly   306 GLLNSCFIYEAAARISPMMACSHGSYDELRIMDAMALPMPNGNPLPPLFDFNSLEMGTDPKLWVN 370
            .|.:....|....|:||:.||:|..:||||..:..   :|:|..|||:|:|:|:|:...|.|...
 Frog   330 TLCSRLLEYTPDTRLSPLQACAHSYFDELRDPNTR---LPSGRELPPIFNFSSVELSIQPSLNSI 391

  Fly   371 LLPIHLSS 378
            |:|.||.|
 Frog   392 LIPPHLQS 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pk34ANP_609603.1 STKc_GSK3 39..334 CDD:271039 117/287 (41%)
S_TKc 45..328 CDD:214567 115/281 (41%)
gsk3aXP_002936450.1 STKc_GSK3 66..358 CDD:271039 117/287 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D990896at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.