DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5122 and LOC101884918

DIOPT Version :9

Sequence 1:NP_609601.1 Gene:CG5122 / 34703 FlyBaseID:FBgn0032471 Length:1263 Species:Drosophila melanogaster
Sequence 2:XP_005173070.2 Gene:LOC101884918 / 101884918 -ID:- Length:123 Species:Danio rerio


Alignment Length:111 Identity:48/111 - (43%)
Similarity:70/111 - (63%) Gaps:0/111 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly  1134 EAINGQGIDRHLFGLQEMALEKGMPIPEFFRSKGYVRSVTFQLFTSQVATSNEGFMAYGPLLSDG 1198
            :|:.|.|:|.||.||:|||.:..|..|:.|..:.|..|..|.|.||||.|..|.|..|||::.||
Zfish     8 QAVTGNGMDNHLLGLREMARQMEMQTPDIFSDETYKISNHFILSTSQVPTEMEMFCCYGPVVPDG 72

  Fly  1199 YGVCYNPKESKITFAISAWKSCKEINTIRFAKAIKKSLNDMRKLIL 1244
            |||||||:...|.|::|:::..||..:.|.|:.::.:|.||:.|.:
Zfish    73 YGVCYNPQSDHIVFSVSSFRENKETCSDRLAEELQVALLDMKDLCM 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5122NP_609601.1 Carn_acyltransf 665..1240 CDD:279140 46/105 (44%)
LOC101884918XP_005173070.2 Carn_acyltransf <8..114 CDD:279140 46/105 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D167256at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.