DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9932 and znf513a

DIOPT Version :9

Sequence 1:NP_609599.1 Gene:CG9932 / 34701 FlyBaseID:FBgn0262160 Length:2171 Species:Drosophila melanogaster
Sequence 2:NP_001296396.1 Gene:znf513a / 568216 ZFINID:ZDB-GENE-030131-9895 Length:548 Species:Danio rerio


Alignment Length:452 Identity:98/452 - (21%)
Similarity:162/452 - (35%) Gaps:111/452 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 VGMDAK-----EEGLPQCKIKRNYSCNHCAYFTQNPRYHLTHLRDVHGEKIVINKCKLCLYASRH 159
            :|:.|:     .||..:....:.:||..|.:.::...:...|::..:|||..  .|.||.|||..
Zfish   152 LGLQAESRGGGNEGTGEDGSLKLHSCTLCGFTSRYTNHVKRHMKTHNGEKPY--GCPLCSYASAQ 214

  Fly   160 FQKLVRHMKMVHG--------CTDGIPSGHGQARGKRGMSREARKRRLEESVGVMGGQSLTVTVP 216
            ...|.||:::..|        ||....|          :....|.:|:..::|  .|||:|..|.
Zfish   215 LVNLQRHLRIHTGEKPYKCNTCTFACSS----------LGNLKRHQRMHATIG--PGQSVTQPVS 267

  Fly   217 ----DVPTLEQVKRELLLQEEKLQRDIQAFNQRQ--REEQQREQQRELELVATSAYERQMQVLRD 275
                :..|..|.::|.:....::...:::..:..  |:....:....|.|    |.:....||:.
Zfish   268 GNGLNHSTAAQKEKEAVPAPTEVAGAVRSVTRPHMGRDGNYLQTFDGLRL----AQQTSTGVLQS 328

  Fly   276 YE--RQSPAEPPTPSPTS----GSATPPSNGEEPQ----------------------NRLLKCSA 312
            .:  .|..|.||...|.:    |.|....:|...|                      :::..|:|
Zfish   329 GQAASQPAALPPMFFPFTCRLCGMALDDEDGSSAQICAKCTLEMLTKDTHGCPAERGDKVYTCAA 393

  Fly   313 CEFTTLYRTQLRAHELAEHGKTKFFRCDKCSYVTHIKARFSKHVKYHS--MPMIKCVTCDFRTPY 375
            |.|.|.|...|..| :..|...|.::|.:|.|.:.......:|.:.|:  .| .||..||:....
Zfish   394 CPFLTHYPNHLARH-MKTHSGEKPYKCPQCDYASAHFDNLKRHHRVHTGEKP-YKCHLCDYACGN 456

  Fly   376 KWNLDRHMKNHGGAGAFKCAACDFTADIKQSLTVH------EMNHHVPPVGNAGSIWPRRQNKVG 434
            ..||.||.:.|.||..|:||.|:::.:...:|..|      |..|.....|.....|        
Zfish   457 LANLKRHQRVHSGAKPFQCAICNYSCNQSMNLKRHMLRHTGEKPHKCQECGYTTGHW-------- 513

  Fly   435 ASEMCEDFLSDSAELEDQYNNNNVDDELDGVDDADEAMSGGEEQPLHLHHYGKRSKYDDEEE 496
                            |.|..:.....|.|        .|..:.||.    |...:.:|:||
Zfish   514 ----------------DNYKRHQKKHSLAG--------DGWVKVPLP----GNEEEVEDDEE 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9932NP_609599.1 C2H2 Zn finger 339..359 CDD:275368 4/19 (21%)
C2H2 Zn finger 366..386 CDD:275368 7/19 (37%)
C2H2 Zn finger 394..414 CDD:275368 6/25 (24%)
C2H2 Zn finger 816..836 CDD:275370
C2H2 Zn finger 844..862 CDD:275370
znf513aNP_001296396.1 C2H2 Zn finger 177..197 CDD:275368 3/19 (16%)
zf-H2C2_2 189..214 CDD:290200 10/26 (38%)
COG5048 201..>503 CDD:227381 75/321 (23%)
C2H2 Zn finger 205..225 CDD:275368 9/19 (47%)
zf-H2C2_2 217..242 CDD:290200 6/24 (25%)
C2H2 Zn finger 233..253 CDD:275368 5/29 (17%)
C2H2 Zn finger 391..411 CDD:275368 8/20 (40%)
zf-H2C2_2 403..428 CDD:290200 7/25 (28%)
C2H2 Zn finger 419..439 CDD:275368 4/19 (21%)
zf-H2C2_2 431..454 CDD:290200 7/23 (30%)
C2H2 Zn finger 447..467 CDD:275368 7/19 (37%)
zf-H2C2_2 459..484 CDD:290200 11/24 (46%)
C2H2 Zn finger 475..495 CDD:275368 5/19 (26%)
zf-H2C2_2 487..510 CDD:290200 5/22 (23%)
C2H2 Zn finger 503..523 CDD:275368 4/43 (9%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.