DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9932 and ZFP64

DIOPT Version :9

Sequence 1:NP_609599.1 Gene:CG9932 / 34701 FlyBaseID:FBgn0262160 Length:2171 Species:Drosophila melanogaster
Sequence 2:NP_060667.2 Gene:ZFP64 / 55734 HGNCID:15940 Length:681 Species:Homo sapiens


Alignment Length:548 Identity:108/548 - (19%)
Similarity:167/548 - (30%) Gaps:153/548 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 INKCKLCLYASRHFQKLVRHMKMVHGCTDGIPSGHGQARGKRGMSREARKRRLEESVGVMGGQSL 211
            |:.|.:|.....:....|.|.:  .||         |..|....:....:...||:|.....|:.
Human    30 IHICGICKQQFNNLDAFVAHKQ--SGC---------QLTGTSAAAPSTVQFVSEETVPATQTQTT 83

  Fly   212 TVTVPDVPTLEQVKRELLLQEEKLQRDIQAFNQRQREEQQREQQRELELVATSAYERQMQVLRDY 276
            |.|:    |.|.....:...|...:...|.:...:..|.|......|                  
Human    84 TRTI----TSETQTITVSAPEFVFEHGYQTYLPTESNENQTATVISL------------------ 126

  Fly   277 ERQSPAEPPTPSPTSGSATPPSNGEEPQNRLLKC-SACEFTTLYRTQLRAHELAEHGKTKFFRCD 340
                ||:..|..||    |||:     |.||..| ..|:|.|.|..:.....|..|...|..:|:
Human   127 ----PAKSRTKKPT----TPPA-----QKRLNCCYPGCQFKTAYGMKDMERHLKIHTGDKPHKCE 178

  Fly   341 KCSYVTHIKARFSKHVKYHS-MPMIKCVTCDFRTPYKWNLDRHMKNHGGAGAFKCAACDFTADIK 404
            .|......|.:...|::.|: :...||.|||:......:|::|::.|.....|||..|.:.:...
Human   179 VCGKCFSRKDKLKTHMRCHTGVKPYKCKTCDYAAADSSSLNKHLRIHSDERPFKCQICPYASRNS 243

  Fly   405 QSLTVHEMNHHVPPVGNAG-SIWPRRQNKVGASEMCEDFLSDSAELEDQYNNNNVDDELDGVDDA 468
            ..||||..:|    .|:|. ..|           :|......|::|:....          |...
Human   244 SQLTVHLRSH----TGDAPFQCW-----------LCSAKFKISSDLKRHMR----------VHSG 283

  Fly   469 DE-----------AMSGGEEQPLHLHHYG-------------------KRSKYDDEEEPTDLSQK 503
            ::           .|.|..:..:.:.|.|                   |.|:....|.|...|: 
Human   284 EKPFKCEFCNVRCTMKGNLKSHIRIKHSGNNFKCPHCDFLGDSKATLRKHSRVHQSEHPEKCSE- 347

  Fly   504 GGCSSDTSSVGTPTPRAQRTMPNLIPISKGAKDVLNLSKETNASRSSLTEIASMFFNEKQISEML 568
              ||...||     ..|.|....:....:..|  .|.........|:|::....|..:...:|.|
Human   348 --CSYSCSS-----KAALRIHERIHCTDRPFK--CNYCSFDTKQPSNLSKHMKKFHGDMVKTEAL 403

  Fly   569 DKSDVPQLSPATTVASQNSTRSQLTKKSSFMDKLKTGAQHENLVCQCGHVAKCLSESIIHGKSCH 633
            ::.|                               ||.|...      .|||..::...|...|.
Human   404 ERKD-------------------------------TGRQSSR------QVAKLDAKKSFHCDICD 431

  Fly   634 ASAVIIDEDEAGLHEDDGDDRLEIDEDD 661
            ||  .:.||....|:....:..|....|
Human   432 AS--FMREDSLRSHKRQHSEYSESKNSD 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9932NP_609599.1 C2H2 Zn finger 339..359 CDD:275368 4/19 (21%)
C2H2 Zn finger 366..386 CDD:275368 6/19 (32%)
C2H2 Zn finger 394..414 CDD:275368 6/19 (32%)
C2H2 Zn finger 816..836 CDD:275370
C2H2 Zn finger 844..862 CDD:275370
ZFP64NP_060667.2 COG5048 <151..450 CDD:227381 72/372 (19%)
zf-H2C2_2 161..186 CDD:290200 5/24 (21%)
C2H2 Zn finger 177..197 CDD:275368 4/19 (21%)
zf-H2C2_2 190..211 CDD:290200 7/20 (35%)
C2H2 Zn finger 205..225 CDD:275368 6/19 (32%)
zf-H2C2_2 217..239 CDD:290200 7/21 (33%)
C2H2 Zn finger 233..253 CDD:275368 6/19 (32%)
C2H2 Zn finger 261..281 CDD:275368 4/40 (10%)
zf-H2C2_2 273..297 CDD:290200 2/33 (6%)
C2H2 Zn finger 289..308 CDD:275368 2/18 (11%)
C2H2 Zn finger 373..391 CDD:275368 3/17 (18%)
zf-C2H2_6 425..450 CDD:290623 7/26 (27%)
C2H2 Zn finger 427..447 CDD:275368 6/21 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144326
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.