DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9932 and wek

DIOPT Version :9

Sequence 1:NP_609599.1 Gene:CG9932 / 34701 FlyBaseID:FBgn0262160 Length:2171 Species:Drosophila melanogaster
Sequence 2:NP_001260472.1 Gene:wek / 48785 FlyBaseID:FBgn0001990 Length:470 Species:Drosophila melanogaster


Alignment Length:425 Identity:80/425 - (18%)
Similarity:127/425 - (29%) Gaps:132/425 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 QAGSSLLERHVERFR-LQQLLQQQRQAAAVVAVVNSVQQQQQQQPQQVGMDAKEEGLPQCKIKRN 117
            :.||.|.|   |.:. :.||:......:.|.|:...::..:.|..|.:.....|.|||.      
  Fly    49 ELGSMLCE---ECYSVIGQLITFSDSVSKVQAIFELLRHSEPQDSQDLDALRLEYGLPP------ 104

  Fly   118 YSCNHCAYFTQNPRYHLTHLRDVHGEKIVINKCKLCLYASRHFQKLVRHMKMVHGCTDGIPSGHG 182
             :|.....|.           |:...:   ::|           .||..:.:....|...|....
  Fly   105 -ACKQDLEFL-----------DIDDTE---DRC-----------SLVEELTISDHSTSPSPDFEA 143

  Fly   183 QARGKRGMSREARKRRLEESVGVMGGQSLTVTVPDVPTLEQVKRELLLQEEKLQRDIQAFNQRQR 247
            |.     :...|..::......|:.  |.|.::|:|.|                       :|.|
  Fly   144 QT-----VRTRANLKQCNSDPKVLA--SPTASIPEVET-----------------------KRSR 178

  Fly   248 EEQQREQQRELELVATSAYERQMQVLRDYERQSPAEPP-----------------TPSPTSGSAT 295
            .:|...::......||.:.:.: .:|.:.|..||  ||                 ..|....|..
  Fly   179 RQQFAAKRNSKVYTATESDDEE-AILDEDEAVSP--PPLKRKRGRPKGSGKQKNVDDSDNVTSRE 240

  Fly   296 PPSNGEEPQNRLLK------------------CSACEFTTLYRTQLRAHELAEHGKTKFFRCDKC 342
            |..|.:..|:....                  |..|..|.:....||.|:...||..|.:.||.|
  Fly   241 PDDNAKSKQDDKTSELSMSPHGSQSSNFVDYPCKICNETFMSFMALRRHKHDMHGGPKKYVCDHC 305

  Fly   343 --------SYVTH--------------------IKARFSKHVKYHSMPMIKCVTCDFRTPYKWNL 379
                    |.|.|                    .|||...|.:.|..|..:|..|..:...:..|
  Fly   306 GKGLKTFTSLVEHQLVHTEEKPCICPVCNAGFKNKARLRVHSQTHGEPKFECNVCGKKLQTRAIL 370

  Fly   380 DRHMKNHGGAGAFKCAACDFTADIKQSLTVHEMNH 414
            ::|...|.....|||..|........:|.:|.:.|
  Fly   371 NKHKYVHTDERRFKCEVCGSGCKNSTALKIHLLGH 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9932NP_609599.1 C2H2 Zn finger 339..359 CDD:275368 10/47 (21%)
C2H2 Zn finger 366..386 CDD:275368 4/19 (21%)
C2H2 Zn finger 394..414 CDD:275368 4/19 (21%)
C2H2 Zn finger 816..836 CDD:275370
C2H2 Zn finger 844..862 CDD:275370
wekNP_001260472.1 zf-AD 11..80 CDD:214871 9/33 (27%)
C2H2 Zn finger 273..294 CDD:275368 6/20 (30%)
C2H2 Zn finger 302..322 CDD:275368 6/19 (32%)
C2H2 Zn finger 330..350 CDD:275368 4/19 (21%)
C2H2 Zn finger 357..377 CDD:275368 4/19 (21%)
C2H2 Zn finger 385..405 CDD:275368 4/19 (21%)
zf-H2C2_2 397..422 CDD:290200 3/9 (33%)
C2H2 Zn finger 413..429 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444642
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.