DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9932 and CG7368

DIOPT Version :9

Sequence 1:NP_609599.1 Gene:CG9932 / 34701 FlyBaseID:FBgn0262160 Length:2171 Species:Drosophila melanogaster
Sequence 2:NP_001036599.1 Gene:CG7368 / 39301 FlyBaseID:FBgn0036179 Length:530 Species:Drosophila melanogaster


Alignment Length:526 Identity:109/526 - (20%)
Similarity:166/526 - (31%) Gaps:168/526 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SGNQLYTEQGGHQPT-SGN--TGHMTSNSTSNTPVAQAGSSLLERHVERFRLQQLLQQQRQAAAV 82
            |||:.   :||.... .|:  .||:.::|...                    ||..|||:...|.
  Fly    83 SGNKF---RGGQDDAIQGDKYNGHLVASSQQQ--------------------QQQQQQQQTQYAT 124

  Fly    83 VAVVN---------------SVQQQQQQQPQQVGMDAKEE-------GLPQCKIKRNYSCNHCAY 125
            ||..:               |.|||||||.||..:.|.:|       .:.|.::.:|.|......
  Fly   125 VAYASATATSAATDALQAGTSGQQQQQQQMQQQQVTAPQELTQDLCNAILQQQVLQNTSWQTLTP 189

  Fly   126 FTQNPRYHLTHLRDVHGEKIVINKCKLCLYASRHFQKLVRHMKMVHGCTDGIPSGHGQARGKRGM 190
            .|....| |:||        ..|...|.|:   ||.|                           .
  Fly   190 GTTVADY-LSHL--------PANTLPLSLH---HFLK---------------------------Y 215

  Fly   191 SREARKRRLEESV-------GVMGGQSLTVTVPDVPTLEQVKRELLLQEEKLQRDIQAFNQRQRE 248
            |.|..|:..:::|       ..:|..:|..|...:|   |...:|.||.:            |:.
  Fly   216 SAETIKKENQQNVVLQVQTGPAIGINTLGTTTISIP---QQAEQLTLQPQ------------QQA 265

  Fly   249 EQQREQQRELELVATSAY------------ERQMQVLRDYERQS---PAEPPTPSPTSGSATPPS 298
            ..|.:.|..:...||:|.            :::.:..|..:|::   |.|....:...||.    
  Fly   266 TLQVQTQAAVTATATTATATTAGGSGATSGKKKKRKKRSKDRKTKLRPGEIRLGTALDGSP---- 326

  Fly   299 NGEEPQNRLLKCSACEFTTLYRTQLRAHELAEHGKTKFFRCDKCSYVTHIKARFSKHVKYHS--M 361
                    |..|..|.........|..| |..|...|.:.||.|......|...::|.:.|:  .
  Fly   327 --------LYMCPECHVAYPEPELLEVH-LVGHNLEKRYVCDICQASLKRKDHLTRHKQSHNPER 382

  Fly   362 PMIKCVTCDFRTPYKWNLDRHMKNHGGAGAFKCAACDFTADIKQSLTVH-----------EMNHH 415
            |.| |..|......|..|..|...|.|....:|..|......|..|..|           |:|.|
  Fly   383 PYI-CTVCLKAFKRKEQLSLHFVIHSGEKRHQCGECGKGFYRKDHLRKHTRSHIARRVKAELNSH 446

  Fly   416 VPPVGNAGSIWPRRQNKVGASEMCEDFLSDSAELEDQYNNN--NVDDELDGVDDADEAMSGGEEQ 478
            |           ||:|   .:.|.:..::::.....|:.|.  :...:|. .....:.....::|
  Fly   447 V-----------RREN---GTSMLQPVVTEATTAALQHANQLASAQQQLQ-QQQQQQQQQQQQQQ 496

  Fly   479 PLHLHH 484
            ....||
  Fly   497 QQQQHH 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9932NP_609599.1 C2H2 Zn finger 339..359 CDD:275368 5/19 (26%)
C2H2 Zn finger 366..386 CDD:275368 5/19 (26%)
C2H2 Zn finger 394..414 CDD:275368 6/30 (20%)
C2H2 Zn finger 816..836 CDD:275370
C2H2 Zn finger 844..862 CDD:275370
CG7368NP_001036599.1 C2H2 Zn finger 330..350 CDD:275368 5/20 (25%)
COG5048 356..>412 CDD:227381 15/56 (27%)
C2H2 Zn finger 358..378 CDD:275368 5/19 (26%)
zf-H2C2_2 370..395 CDD:290200 6/25 (24%)
C2H2 Zn finger 386..406 CDD:275368 5/19 (26%)
zf-H2C2_2 399..423 CDD:290200 6/23 (26%)
zf-C2H2 412..434 CDD:278523 5/21 (24%)
C2H2 Zn finger 414..434 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.