DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9932 and CG15073

DIOPT Version :9

Sequence 1:NP_609599.1 Gene:CG9932 / 34701 FlyBaseID:FBgn0262160 Length:2171 Species:Drosophila melanogaster
Sequence 2:NP_611362.2 Gene:CG15073 / 37155 FlyBaseID:FBgn0034379 Length:580 Species:Drosophila melanogaster


Alignment Length:420 Identity:75/420 - (17%)
Similarity:127/420 - (30%) Gaps:151/420 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 CKLCLYASRHFQKLVRHMKMVHGCTD---GIPSGHGQARGKRGMSREARKRRLEE--SVGVMGGQ 209
            |..|......|.:....::..|....   .:.||..|.:.:.|...|.::...:|  .:|:.|.:
  Fly    51 CLTCWNQVNDFHQFYVAVESAHRLLTERFSLKSGQDQGKVEHGEDSEQQEEEQDEDQELGLPGSE 115

  Fly   210 SLTVTVPDVPTLEQVKRELLLQEEK-----------LQRDIQAFNQRQREEQ-QREQQRELELVA 262
            ..:.      |.||...|::.|:|:           ::.|....|..:.... ..||:||....|
  Fly   116 GGSF------TNEQFLTEVIAQQEQQTDSNPPKEQFIKEDNATVNDPETSATLPTEQRRETRSTA 174

  Fly   263 TSAYERQMQVLRDYERQSPAEPPTPS------------PTSGSATPPSN---------------- 299
            .|         :.:....|:.||..|            |.....||..:                
  Fly   175 KS---------KAHHSLPPSTPPEKSNSVANKSKAKRTPCKAEGTPQKSKRYADYKQCMLDIDAK 230

  Fly   300 --------------GEE-----------------------------------------PQNRLLK 309
                          |:|                                         |:.  .|
  Fly   231 ISAHMRLTCDVCHEGQETFLLLCKHMLQEHHRKGYAICCNKKFYKRSFLTDHIDRHADPEK--FK 293

  Fly   310 CSACEFTTLYRTQLRAHELAEH--GKTKFFRCDKCSYVTHIKARFSK------HVKYHSMPMIKC 366
            |:.|:.....:..||.|||.:|  .:.|.|.|::|      ..|::|      |...|....:.|
  Fly   294 CTQCDKRFADKQCLRNHELLKHHPEEEKTFMCEQC------PKRYTKQYLLDQHRVIHKERNVVC 352

  Fly   367 VTCDFRTPYKWNLDRHMK-NHGGAGAFKCAACDFTADI---KQSLTVHEMNHHVPPVGNAGSIWP 427
            ..|:.|.|.:..|..|:| .||..|..    ||..|.:   :.:...|::.|       ||...|
  Fly   353 DLCERRFPNQSLLCTHVKMAHGNYGTM----CDICAQVIRGRAAFQRHQLEH-------AGVTEP 406

  Fly   428 RRQNKVGASEMCEDFLSDSAELEDQYNNNN 457
            :.|     .::|..:..:...|:.....:|
  Fly   407 KVQ-----CDICGSWHKNKHSLKKHVRRHN 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9932NP_609599.1 C2H2 Zn finger 339..359 CDD:275368 5/25 (20%)
C2H2 Zn finger 366..386 CDD:275368 7/20 (35%)
C2H2 Zn finger 394..414 CDD:275368 4/22 (18%)
C2H2 Zn finger 816..836 CDD:275370
C2H2 Zn finger 844..862 CDD:275370
CG15073NP_611362.2 zf-AD 2..78 CDD:285071 4/26 (15%)
C2H2 Zn finger 269..286 CDD:275368 0/16 (0%)
C2H2 Zn finger 294..316 CDD:275368 7/21 (33%)
C2H2 Zn finger 325..345 CDD:275368 5/25 (20%)
C2H2 Zn finger 352..370 CDD:275368 6/17 (35%)
C2H2 Zn finger 410..430 CDD:275368 2/19 (11%)
C2H2 Zn finger 437..458 CDD:275368
C2H2 Zn finger 466..486 CDD:275368
C2H2 Zn finger 494..512 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.