DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9932 and CG4282

DIOPT Version :9

Sequence 1:NP_609599.1 Gene:CG9932 / 34701 FlyBaseID:FBgn0262160 Length:2171 Species:Drosophila melanogaster
Sequence 2:NP_611118.3 Gene:CG4282 / 36825 FlyBaseID:FBgn0034114 Length:652 Species:Drosophila melanogaster


Alignment Length:378 Identity:77/378 - (20%)
Similarity:128/378 - (33%) Gaps:115/378 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 VQQQQQQQPQQVGMDAK--EEGLPQCKIKRNYSCNHCAY-FTQNPRYH-LTH------------- 136
            ::|:::||.:...:.||  ...|| |.|     ||...: ||:..|:| |||             
  Fly   306 LEQRKKQQEEYDVIIAKFFTSVLP-CAI-----CNLLVHNFTEMQRHHRLTHQVDPGYMMCCGRK 364

  Fly   137 --LRDVHGEKIVIN------KCKLC---LYASRHFQKLVR-HM----KMVHGCTDGIPSGHGQAR 185
              .|.|..|.::::      ||.:|   ...|||.:...: ||    |:...|         ...
  Fly   365 FTQRKVLAEHVLVHWNPDHFKCSVCEKSFQNSRHLESHQQVHMDPAVKLTFSC---------DLC 420

  Fly   186 GKRGMSREARKRRLEESVGVMGGQSLTVTVPDVP---TLEQVKRELLLQEEKLQRDIQAFNQRQR 247
            .|..:|:.|           :....|...||...   |..:..:: .|.|.||:..:.:.:..: 
  Fly   421 SKTFLSKTA-----------IDYHKLNKHVPKSEFKFTCSECNKK-FLTERKLKNHMSSMHDPE- 472

  Fly   248 EEQQREQQRELELVATSAYERQMQ---VLRDYERQSPAEPPTPSPTSGSATPPSNGEEPQNRLLK 309
                       ..:......:||:   :|:.::....::.|.|.|                .|.:
  Fly   473 -----------STIICDKCGKQMRTKIILKKHQELMHSDKPRPEP----------------ELQQ 510

  Fly   310 CSACEFTTLYRTQLRAH-------ELAEHGKTKFFRCDKCSYVTHIKARFSKHVKYHSMP---MI 364
            |..|.......|.|:.|       ...||      ||..|:.|:.......:|: ||:..   ..
  Fly   511 CQICGAWLKGMTGLKQHMKSIHVESAGEH------RCHICAKVSPNARALRRHI-YHNHECERKF 568

  Fly   365 KCVTCD--FRTPYKWNLDRHMKNHGGAGAFKCAACDFTADIKQSLTVHEMNHH 415
            ||..|:  |:.|.:  |..|...|.|...:.|..|..|.....::..|....|
  Fly   569 KCTMCEKAFKRPQE--LKEHTSTHTGEVLYTCPNCPMTFFCSANMYKHRQRLH 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9932NP_609599.1 C2H2 Zn finger 339..359 CDD:275368 4/19 (21%)
C2H2 Zn finger 366..386 CDD:275368 6/21 (29%)
C2H2 Zn finger 394..414 CDD:275368 4/19 (21%)
C2H2 Zn finger 816..836 CDD:275370
C2H2 Zn finger 844..862 CDD:275370
CG4282NP_611118.3 zf-AD 7..81 CDD:285071
FYDLN_acid <191..268 CDD:302856
C2H2 Zn finger 330..351 CDD:275368 9/25 (36%)
C2H2 Zn finger 360..378 CDD:275368 3/17 (18%)
LIM 361..>400 CDD:295319 9/38 (24%)
C2H2 Zn finger 386..406 CDD:275368 5/19 (26%)
zf-C2H2_8 389..465 CDD:292531 19/96 (20%)
C2H2 Zn finger 417..438 CDD:275368 5/40 (13%)
C2H2 Zn finger 448..465 CDD:275368 4/17 (24%)
C2H2 Zn finger 477..498 CDD:275368 3/20 (15%)
C2H2 Zn finger 511..532 CDD:275368 5/20 (25%)
C2H2 Zn finger 541..562 CDD:275368 6/21 (29%)
C2H2 Zn finger 570..590 CDD:275368 6/21 (29%)
C2H2 Zn finger 598..619 CDD:275368 4/20 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444648
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.