DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9932 and CG8388

DIOPT Version :9

Sequence 1:NP_609599.1 Gene:CG9932 / 34701 FlyBaseID:FBgn0262160 Length:2171 Species:Drosophila melanogaster
Sequence 2:NP_611075.1 Gene:CG8388 / 36763 FlyBaseID:FBgn0034062 Length:572 Species:Drosophila melanogaster


Alignment Length:623 Identity:113/623 - (18%)
Similarity:197/623 - (31%) Gaps:229/623 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 SSLLERHVERFRLQQLLQQQRQAAAVVAVVNSVQQQQQQQPQQVG-MDAKEE--------GLPQC 112
            :|.||.|:        ::.:...:...||     ::::.:|::|. .||:||        .|.:.
  Fly    90 ASALEEHI--------VKSEHDDSVAAAV-----KRRRGRPRKVAQQDAREELKSVLEQINLNEI 141

  Fly   113 KIKRNYSCNHCAYFTQNPRYHLT---HLRDVHGEKIVINKCKLCLYASRH-------FQKLVRHM 167
            ||             :.|...||   .|.|...:..:.:.|     .|:.       .:|....:
  Fly   142 KI-------------EFPEADLTIADVLEDQEEQDFLPDDC-----ISKEGAEDPEVLEKKPPTL 188

  Fly   168 KMVHGCTDGIPSGHGQARGKRGMSREARKRRLEESVGVMGGQSLTVTVPDVPTLEQVKR-----E 227
            |                |...|.||..|:.:|.|.             |:...|.::::     :
  Fly   189 K----------------RKVSGRSRGRRRVQLAER-------------PNTSCLPKIQKSQEFND 224

  Fly   228 LLLQEEKLQRDI-----QAFNQRQREEQQREQQRELELVATSAYERQMQVLRDYERQSPAEPPTP 287
            .:.:..|:|..|     :.|::.....::..:||...:.....:.:: .||.|:.|:.       
  Fly   225 YIREHYKVQCHICNLPMEDFSEMLAHVRREHKQRGYAMCCNRKFLKR-GVLVDHLRRH------- 281

  Fly   288 SPTSGSATPPSNGEEPQNRLLKCSACEFTTLYRTQL----RAHELAEHGKTKFFRCDKCSYVTHI 348
                         ::|:.  .|||.|.....:|..|    |.||:...|  :.:||::||...:.
  Fly   282 -------------QDPET--FKCSICGRVMGHRRSLELHMRMHEIKSRG--RLYRCEQCSKAFYS 329

  Fly   349 KARFSKHVKYHSMP----MIKCVTCDFRTPYKWN-----------------------------LD 380
            ...:.:|...| :|    .:.|..|:...|.::.                             |.
  Fly   330 AVVYERHKLTH-IPREQWKVPCTHCEKTYPSQYTMQQHVKLVHLNLYAKICDVCGKSIRGREALA 393

  Fly   381 RHMKNHGGA--GAFKCAACDFTADIKQSLTVHEMNHHVPPVGNAGSIWPRRQNKVGASEMCEDFL 443
            |||:.|.|.  .|.||..||.....|..|.     .|:..:..|.::.|.:         ||..|
  Fly   394 RHMEEHTGGPQAAIKCHLCDSMLTTKYGLA-----RHIKMMHTAENLQPMQ---------CEFCL 444

  Fly   444 SDSAELEDQYNNNNVDDELDGVDDADEAMSGGEEQPLHLHHYGKRSKYDDE-------------- 494
            .....|:                             .|.||.    ||...              
  Fly   445 KICPSLQ-----------------------------AHQHHI----KYTHNTARSHQCPMCEKAF 476

  Fly   495 EEPTDLSQKGGCSSDTSSVGTPTPRAQRTMPNLIPISKGAKDV------LNLSKETNASRSSLTE 553
            :.|.:|  |...::.|..|....|...:|..:...:....|.|      .|..|..|.||.|.|.
  Fly   477 KRPNEL--KEHMTTHTGEVLYTCPHCPQTFNSNANMHAHRKKVHRKEWEENRHKRLNRSRKSDTI 539

  Fly   554 IASMFFNEKQISEMLDKSDVPQLSPATTVASQNSTRSQ 591
            ||      ..:.:..:......|.||..:|:.:|.|::
  Fly   540 IA------VSVRKTTETRQDGGLVPAEAIATTSSPRAE 571

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9932NP_609599.1 C2H2 Zn finger 339..359 CDD:275368 4/19 (21%)
C2H2 Zn finger 366..386 CDD:275368 7/48 (15%)
C2H2 Zn finger 394..414 CDD:275368 5/19 (26%)
C2H2 Zn finger 816..836 CDD:275370
C2H2 Zn finger 844..862 CDD:275370
CG8388NP_611075.1 zf-AD <21..77 CDD:285071
C2H2 Zn finger 264..281 CDD:275368 4/17 (24%)
C2H2 Zn finger 289..309 CDD:275368 6/19 (32%)
C2H2 Zn finger 320..340 CDD:275368 4/19 (21%)
C2H2 Zn finger 350..369 CDD:275368 3/18 (17%)
C2H2 Zn finger 440..461 CDD:275368 9/53 (17%)
C2H2 Zn finger 469..489 CDD:275368 3/21 (14%)
C2H2 Zn finger 497..515 CDD:275368 2/17 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444652
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.