| Sequence 1: | NP_609599.1 | Gene: | CG9932 / 34701 | FlyBaseID: | FBgn0262160 | Length: | 2171 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001370327.1 | Gene: | tra-4 / 180575 | WormBaseID: | WBGene00018740 | Length: | 543 | Species: | Caenorhabditis elegans |
| Alignment Length: | 323 | Identity: | 60/323 - (18%) |
|---|---|---|---|
| Similarity: | 97/323 - (30%) | Gaps: | 130/323 - (40%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 216 PDVPTLEQVKRELLLQE---------EKLQRDIQAFNQRQR-----EEQQREQQRELELVATSAY 266
Fly 267 E----RQMQ----VLRDYERQSPAEPPT----PSPTSGSATP----------------------- 296
Fly 297 ----------------------------------------------------------PSNGEEP 303
Fly 304 QNRLL--------------KCSACEFTTLYRTQLRAHELAEHGKTKFFRCDKCSYVTHIKARFSK 354
Fly 355 HVKYHS-MPMIKCVTCDFRTPYKWNLDRHMKNHGGAGAFKCAACDFTADIKQSLTVHEMNHHV 416 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG9932 | NP_609599.1 | C2H2 Zn finger | 339..359 | CDD:275368 | 3/19 (16%) |
| C2H2 Zn finger | 366..386 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 394..414 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 816..836 | CDD:275370 | |||
| C2H2 Zn finger | 844..862 | CDD:275370 | |||
| tra-4 | NP_001370327.1 | COG5236 | <329..>519 | CDD:227561 | 35/194 (18%) |
| C2H2 Zn finger | 415..436 | CDD:275368 | 7/20 (35%) | ||
| C2H2 Zn finger | 444..464 | CDD:275368 | 3/19 (16%) | ||
| C2H2 Zn finger | 472..490 | CDD:275368 | 6/17 (35%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S8328 |
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.950 | |||||