DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment APOD and NLaz

DIOPT Version :10

Sequence 1:NP_001638.1 Gene:APOD / 347 HGNCID:612 Length:189 Species:Homo sapiens
Sequence 2:NP_001259867.1 Gene:NLaz / 33324 FlyBaseID:FBgn0053126 Length:245 Species:Drosophila melanogaster


Alignment Length:189 Identity:73/189 - (38%)
Similarity:101/189 - (53%) Gaps:7/189 - (3%)


- Green bases have known domain annotations that are detailed below.


Human     4 LLLLLSALAGLFGAAEGQAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENG-RCIQANYS 67
            ||||:|.:.|....|..|....||||:..:.:.||...|:|.|||....|..||.| :||.||||
  Fly     9 LLLLISVVFGAVWVAHAQVPFPGKCPDVKLLDTFDAEAYMGVWYEYAAYPFAFEIGKKCIYANYS 73

Human    68 LMENGKIKVLNQEL-RADGTVNQIEGEATPVNLTEPAKLEVKFSWFMP--SAPYWILATDYENYA 129
            |::|..:.|:|..: |..|..:.:.|:|   .:..|.:|.|.|....|  .|.|.:|.||||:||
  Fly    74 LIDNSTVSVVNAAINRFTGQPSNVTGQA---KVLGPGQLAVAFYPTQPLTKANYLVLGTDYESYA 135

Human   130 LVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKL 188
            :|||||.:..|.:....|||.|......|.||:.:.||..|::....:..|.|.|||:|
  Fly   136 VVYSCTSVTPLANFKIVWILTRQREPSAEAVDAARKILEDNDVSQAFLIDTVQKNCPRL 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
APODNP_001638.1 lipocalin_apoD-like 25..182 CDD:381212 60/160 (38%)
NLazNP_001259867.1 lipocalin_apoD-like 30..188 CDD:381212 60/160 (38%)

Return to query results.
Submit another query.