DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ube4B and ybiA

DIOPT Version :10

Sequence 1:NP_609597.1 Gene:Ube4B / 34699 FlyBaseID:FBgn0032467 Length:1217 Species:Drosophila melanogaster
Sequence 2:NP_415319.1 Gene:ybiA / 945426 ECOCYCID:EG11579 Length:160 Species:Escherichia coli


Alignment Length:113 Identity:25/113 - (22%)
Similarity:49/113 - (43%) Gaps:25/113 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   633 NIEQDTKIRY--SEEEYRNFLARDFSQPVENTNFQTQCWFLTLQAHHLGYLPAIQRYRQKVRAIK 695
            ::.|||.|.:  :.::|.:|           :||  ..|.:.:...   ..|..:.|.|..:.:.
E. coli    10 HVMQDTIINFYSTSDDYGDF-----------SNF--AAWPIKVDGK---TWPTSEHYFQAQKFLD 58

  Fly   696 ELQKLIDELDRTKSHWMNSRYA-NRNNQFKERW----EKQLRKLNRSK 738
            |  |..:|:.|..|..:.:|.. :|:...::.|    |:.:||..|:|
E. coli    59 E--KYREEIRRVSSPMVAARMGRDRSKPLRKNWESVKEQVMRKALRAK 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ube4BNP_609597.1 Ufd2P_core 510..1124 CDD:463080 25/113 (22%)
RING-Ubox_UBE4B 1138..1211 CDD:438320
ybiANP_415319.1 RibX 10..157 CDD:442468 25/113 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.