DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG9934 and UBOX5

DIOPT Version :9

Sequence 1:	NP_001162967.1	Gene:	CG9934 / 34699	FlyBaseID:	FBgn0032467	Length:	1217	Species:	Drosophila melanogaster
Sequence 2:	NP_055763.1	Gene:	UBOX5 / 22888	HGNCID:	17777	Length:	541	Species:	Homo sapiens

Alignment Length:	187	Identity:	42/187 - (22%)
Similarity:	69/187 - (36%)	Gaps:	74/187 - (39%)

- Green bases have known domain annotations that are detailed below.

  Fly  1025 ELVDRLSSMLNFNLKQLAGPKCNDLKVKNPAKYGWEPRSLLAQIFDIYLHLDCDRFAEALAADER 1089
            |::|.:..:.:.||.|       |:.::.||               :.:..|||
Human   204 EVIDSILLVTSENLPQ-------DVALQAPA---------------LPMESDCD----------- 235

  Fly  1090 SFDVQICNEAASRIKRLALRSAVEVERFKALTQRAHEIYVTNLQTEDECADAPDEFKDPLMDTLM 1154
            ..|.....:|.|.:::||                  ||          ..|.|:||.||:...:|
Human   236 PGDQPESQQAPSSLQKLA------------------EI----------IQDVPEEFLDPITLEIM 272

  Fly  1155 SDPVVLPSGTVMDRAIITRHLLNSCT------DPF-------NRQPLTEDMLVANIE 1198
            ..|::||||.|:|::.:.:...:..|      |||       :.|||....|.|.|:
Human   273 PCPMLLPSGKVIDQSTLEKCNRSEATWGRVPSDPFTGVAFTPHSQPLPHPSLKARID 329

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG9934	NP_001162967.1	Ufd2P_core	510..1124	CDD:287392	16/98 (16%)
CG9934	NP_001162967.1	U-box	1141..1211	CDD:252675	23/71 (32%)
UBOX5	NP_055763.1	RING-Ubox_RNF37	260..312	CDD:319574	17/51 (33%)
		U-box domain, a modified RING finger	265..308	CDD:319574	13/42 (31%)
		RING-HC_RNF37	482..528	CDD:319451
		RING-HC finger (C3HC4-type)	483..527	CDD:319451
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5113
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900