DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yip1d1 and Yipf4

DIOPT Version :9

Sequence 1:NP_609596.1 Gene:Yip1d1 / 34696 FlyBaseID:FBgn0032465 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001009712.1 Gene:Yipf4 / 362699 RGDID:1310157 Length:246 Species:Rattus norvegicus


Alignment Length:254 Identity:69/254 - (27%)
Similarity:112/254 - (44%) Gaps:47/254 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PPNYDASYAQPPSQGLGGFYDPTAYTDTSYGQDKSGKSAAGG-----GAGNEF------------ 92
            ||....:||  |:.|     |.| :..::..:|.||..||..     |...:|            
  Rat     3 PPGPPPAYA--PANG-----DFT-FVSSADAEDLSGSIAAPDVKLNLGVSGDFIKESTATTFLRQ 59

  Fly    93 ----------DDEP----PLLEELGINPNHIFQKTLAVLNPL--RGTDQQILQDT-DMAGPLVFC 140
                      |::|    ||||||.|:...|:.|...||.|:  .|.::|:::|. |..|||...
  Rat    60 RGYGWLLEVEDEDPEDNKPLLEELDIDLKDIYYKIRCVLMPMPSLGFNRQVVRDNPDFWGPLAVV 124

  Fly   141 LTLGGFLLLSGKVTFSYIYGIGVMGCIFFYCLLSLMVSRSQVTFGAVASVLGYCLLPMVVLSGIN 205
            |......|.......|:|..|.:.|.:..:.|..::  ..:|.:|.|..|:||.|||::|::.|.
  Rat   125 LFFSMISLYGQFRVVSWIITIWIFGSLTIFLLARVL--GGEVAYGQVLGVIGYSLLPLIVIAPIL 187

  Fly   206 ILITIQGTLGLIVSGISIFWCAISASKLFATAFSMDHQQLLIAYPCAVLYGGFALITIY 264
            :::.....:..::....:||.|.||:.|.........:.||| ||..:||..|  :::|
  Rat   188 LVVGSFEMVSTLIKLFGVFWAAYSAASLLVGEEFKTKKPLLI-YPIFLLYIYF--LSLY 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yip1d1NP_609596.1 Yip1 <95..264 CDD:304430 52/175 (30%)
Yipf4NP_001009712.1 Yip1 <76..239 CDD:419731 50/165 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5080
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.