DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yip1d1 and CG3652

DIOPT Version :9

Sequence 1:NP_609596.1 Gene:Yip1d1 / 34696 FlyBaseID:FBgn0032465 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_608828.2 Gene:CG3652 / 33643 FlyBaseID:FBgn0031600 Length:224 Species:Drosophila melanogaster


Alignment Length:191 Identity:49/191 - (25%)
Similarity:78/191 - (40%) Gaps:27/191 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 SAAGGGAGNEFDDEPPLLEELGINPNHIFQKTLAVLNPLRGTDQQILQDTDMAGPLVFCLTLGGF 146
            ||:|....|..|:  |:.|.:..:...:..|...||.|..  ...:|:|.|:.||||.|..:.  
  Fly    33 SASGVPEYNTLDE--PIRETVLRDIRAVGIKFYHVLYPKE--KSSLLRDWDLWGPLVLCTFMA-- 91

  Fly   147 LLLSGKVT----------FSYIYGIGVMGCIFFYCLLSLMVSRSQVTFGAVASVLGYCLLPMVVL 201
            .:|.|..|          |:.::.|..:|..  ...|:..:....::|.....||||||.| |.:
  Fly    92 TILQGSSTADSMSDNGPEFAQVFVIVWIGAA--VVTLNSKLLGGNISFFQSVCVLGYCLTP-VAI 153

  Fly   202 SGINILITIQGT-------LGLIVSGISIFWCAISASKLFATAFSMDHQQLLIAYPCAVLY 255
            |.|...:.:..|       |..:.:.|...| |..||.:|.......|::.|..||..:.:
  Fly   154 SLIVCRVILLATQTRLLFFLRFVTTTIGFAW-ATYASFVFLGQSQPPHRKPLAVYPIFLFF 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yip1d1NP_609596.1 Yip1 <95..264 CDD:304430 44/178 (25%)
CG3652NP_608828.2 Yip1 <31..221 CDD:304430 49/191 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450205
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5080
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.