DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yip1d1 and YIPF6

DIOPT Version :9

Sequence 1:NP_609596.1 Gene:Yip1d1 / 34696 FlyBaseID:FBgn0032465 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_776195.2 Gene:YIPF6 / 286451 HGNCID:28304 Length:236 Species:Homo sapiens


Alignment Length:163 Identity:47/163 - (28%)
Similarity:74/163 - (45%) Gaps:28/163 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 QKTLAVLNPLRGTDQQILQDTDMAGPLVFCLTLGGFLLL---------SGKVTFSYIYGIGVMGC 166
            :|.:.||.|.:  ...:|:|.|:.|||:.|:||.  |:|         .|...|:.::.|...|.
Human    71 KKFMHVLYPRK--SNTLLRDWDLWGPLILCVTLA--LMLQRDSADSEKDGGPQFAEVFVIVWFGA 131

  Fly   167 IFFYCLLSLMVSRSQVTFGAVASVLGYCLLPMVVLSGI--NILITIQGTLGLIVS---GISIFWC 226
            :..  .|:..:....::|.....|||||:||:.|...|  .:|:...|.:..:|.   .|.:|..
Human   132 VTI--TLNSKLLGGNISFFQSLCVLGYCILPLTVAMLICRLVLLADPGPVNFMVRLFVVIVMFAW 194

  Fly   227 AISASKLFATAFSMDHQ----QLLIAYPCAVLY 255
            :|.||    |||..|.|    :.|..||..:.|
Human   195 SIVAS----TAFLADSQPPNRRALAVYPVFLFY 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yip1d1NP_609596.1 Yip1 <95..264 CDD:304430 47/163 (29%)
YIPF6NP_776195.2 Yip1 <54..231 CDD:389810 47/163 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5080
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.