powered by:
Protein Alignment Yip1d1 and T08D2.6
DIOPT Version :9
Sequence 1: | NP_609596.1 |
Gene: | Yip1d1 / 34696 |
FlyBaseID: | FBgn0032465 |
Length: | 264 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001380088.1 |
Gene: | T08D2.6 / 188284 |
WormBaseID: | WBGene00011611 |
Length: | 69 |
Species: | Caenorhabditis elegans |
Alignment Length: | 32 |
Identity: | 17/32 - (53%) |
Similarity: | 21/32 - (65%) |
Gaps: | 1/32 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 90 NEFD-DEPPLLEELGINPNHIFQKTLAVLNPL 120
||.| |:.||||||.|:...|:.|...||:||
Worm 21 NEEDSDQIPLLEELDIDLTDIYYKIRCVLHPL 52
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Yip1d1 | NP_609596.1 |
Yip1 |
<95..264 |
CDD:304430 |
13/26 (50%) |
T08D2.6 | NP_001380088.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5080 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.