DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yip1d1 and T08D2.6

DIOPT Version :9

Sequence 1:NP_609596.1 Gene:Yip1d1 / 34696 FlyBaseID:FBgn0032465 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001380088.1 Gene:T08D2.6 / 188284 WormBaseID:WBGene00011611 Length:69 Species:Caenorhabditis elegans


Alignment Length:32 Identity:17/32 - (53%)
Similarity:21/32 - (65%) Gaps:1/32 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 NEFD-DEPPLLEELGINPNHIFQKTLAVLNPL 120
            ||.| |:.||||||.|:...|:.|...||:||
 Worm    21 NEEDSDQIPLLEELDIDLTDIYYKIRCVLHPL 52

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yip1d1NP_609596.1 Yip1 <95..264 CDD:304430 13/26 (50%)
T08D2.6NP_001380088.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5080
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.