DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yip1d1 and yipf7

DIOPT Version :9

Sequence 1:NP_609596.1 Gene:Yip1d1 / 34696 FlyBaseID:FBgn0032465 Length:264 Species:Drosophila melanogaster
Sequence 2:XP_002933510.2 Gene:yipf7 / 100492489 XenbaseID:XB-GENE-983349 Length:246 Species:Xenopus tropicalis


Alignment Length:228 Identity:108/228 - (47%)
Similarity:148/228 - (64%) Gaps:27/228 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 GFYDPTAYTDTSYGQDKSGKSAAG------GGAG------------------NE-FDDEPPLLEE 101
            |.||...:.:.| .|.|:..|.||      ..||                  || |:||||||||
 Frog    21 GIYDTGTFVENS-RQSKNDFSQAGTFSAITHHAGVPYEPAYSPSFHSEQNQHNESFEDEPPLLEE 84

  Fly   102 LGINPNHIFQKTLAVLNPLRGTDQQILQDTDMAGPLVFCLTLGGFLLLSGKVTFSYIYGIGVMGC 166
            ||||.:||:||||.||||.:..|..||.:||:.|||:||..||..|||:||:.|.|:|.:.::||
 Frog    85 LGINFDHIWQKTLTVLNPWKPADGSILNETDLTGPLIFCFALGSMLLLAGKIHFGYVYTMSILGC 149

  Fly   167 IFFYCLLSLMVSRSQVTFGAVASVLGYCLLPMVVLSGINILITIQGTLGLIVSGISIFWCAISAS 231
            :..:.||:|| |.:.|::|.|||||||||||||:||...:|.::||.:|.:::...|.||:.|||
 Frog   150 LGIHALLNLM-SITGVSYGCVASVLGYCLLPMVILSCCAVLFSLQGIIGTVLAAAIIGWCSFSAS 213

  Fly   232 KLFATAFSMDHQQLLIAYPCAVLYGGFALITIY 264
            |:|.:..:|:.||||:|||||:|||.|||:.::
 Frog   214 KMFISTLAMEGQQLLVAYPCALLYGLFALLAVF 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yip1d1NP_609596.1 Yip1 <95..264 CDD:304430 93/168 (55%)
yipf7XP_002933510.2 Yip1 <78..246 CDD:389810 93/168 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 164 1.000 Domainoid score I3888
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 232 1.000 Inparanoid score I3344
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457080at2759
OrthoFinder 1 1.000 - - FOG0001876
OrthoInspector 1 1.000 - - otm48591
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1236
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.