DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXC and npr3

DIOPT Version :9

Sequence 1:NP_609593.1 Gene:ACXC / 34689 FlyBaseID:FBgn0040508 Length:1130 Species:Drosophila melanogaster
Sequence 2:XP_005165413.1 Gene:npr3 / 569395 ZFINID:ZDB-GENE-060531-91 Length:503 Species:Danio rerio


Alignment Length:305 Identity:48/305 - (15%)
Similarity:107/305 - (35%) Gaps:71/305 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 QSENSPDRFQMGP---RTTESFMAIQIHPDVSILYADVV---------NYTHLTTTL-TVGNLVK 339
            |.:..|| ..:||   ....|...:..|.::.::.|..:         .|:|||... |...:.:
Zfish    90 QKDERPD-LVLGPVCEYAASSVTRVASHWNIPVISAGALATGFNSKTPEYSHLTRIAPTYLKMAE 153

  Fly   340 VLHDLYGRFDIAASNFKVQRIKFLGDCYYCVAGLTTPDPDHAKCCVSLGISMISNIQEVRAERGL 404
            ....::|.|....:.......|...:||:.:.|:.|...::.   :|...:::::.:|     .:
Zfish   154 TFQAIFGHFGWRTAYLIYDDDKDERNCYFTMEGVFTVLSEYH---ISTDFAVLNSNEE-----RV 210

  Fly   405 DIDMRIGVHSGSLLAGIIGEAKLQFDIWGTDVEIANHLESTGEPGYVHVSGRTLSMLNPADYTIL 469
            |.|..|....||.:..:..:|.:.     .|:.:|.|........::..:   :.:.|.:.|...
Zfish   211 DPDGIITSVYGSEVVIMCSKADIV-----RDLMLAAHRRKLTSDSHIFFN---IELFNSSSYGDG 267

  Fly   470 SGTQKAQSDPVLQYIHTYLLTGQVARESFITSIGGVRSSSVLEVKSIDRIRSSRPSQSSMTDEFR 534
            |..::.:.|...:..:::|.|                         :..:||::|.....:.|.:
Zfish   268 SWRRRDKYDDEARAAYSFLNT-------------------------VTLLRSTKPEFEDFSIEMK 307

  Fly   535 EEFRNMPVGGINLNSPCCRRTRLDTHKKTQREIGIFCAAFKDSSL 579
            :..:..       |.|.|         :....:.:|...|.|:.|
Zfish   308 KSLQQS-------NIPIC---------EDCSAVNMFMEGFHDALL 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXCNP_609593.1 AC_N <33..285 CDD:292831
CYCc 293..468 CDD:214485 32/187 (17%)
Nucleotidyl_cyc_III 307..466 CDD:299850 26/168 (15%)
CYCc 833..1060 CDD:214485
Nucleotidyl_cyc_III 861..1085 CDD:299850
npr3XP_005165413.1 Periplasmic_Binding_Protein_Type_1 29..416 CDD:299141 48/305 (16%)
ANF_receptor 46..389 CDD:279440 48/305 (16%)
TM_EphA1 436..468 CDD:214014
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.