DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXC and npr1a

DIOPT Version :9

Sequence 1:NP_609593.1 Gene:ACXC / 34689 FlyBaseID:FBgn0040508 Length:1130 Species:Drosophila melanogaster
Sequence 2:NP_001038402.1 Gene:npr1a / 560653 ZFINID:ZDB-GENE-060503-539 Length:1067 Species:Danio rerio


Alignment Length:300 Identity:72/300 - (24%)
Similarity:139/300 - (46%) Gaps:47/300 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 STDILHNLGFNMMGIFFRIMNDTMVRASFLDR------------HQFIMEETWLRHALLQES-IL 265
            |.|:.....|:.:.:..| .|:....::.||.            .:.:.|.|...|...::: .|
Zfish   792 SEDVNERPDFSQIKVLLR-KNNCGYGSNILDNLLSRMEQYANNLEELVEERTQAYHEEKRKAEAL 855

  Fly   266 LDSILPPQIAKPVQEKIKSKITQSENSPDRFQMGPRTTESFMAIQIHPDVSILYADVVNYTHLTT 330
            |..|||..:|:.::   :.::.|:|                    ....|:|.::|:|.:|.|:.
Zfish   856 LYQILPHSVAEQLK---RGEMVQAE--------------------AFDSVTIYFSDIVGFTALSA 897

  Fly   331 TLTVGNLVKVLHDLYGRFDIAASNFKVQRIKFLGDCYYCVAGLTTPDPD-HAKCCVSLGISMISN 394
            ..|...:|.:|:|||..||....||.|.:::.:||.|..|:||...:.. ||:....:.::::..
Zfish   898 ESTPMEVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHAREIARMSLALLEA 962

  Fly   395 IQ--EVRAERGLDIDMRIGVHSGSLLAGIIGEAKLQFDIWGTDVEIANHLESTGEPGYVHVSGRT 457
            :.  .:|....|.:.:|||:|||.:.||::|....::.::|..|..|:.:||.||...:|||..|
Zfish   963 VHSFRIRHRPNLQLRLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHVSEAT 1027

  Fly   458 LSMLNPADYTILSGTQKAQSDPVLQ---YIHTYLLTGQVA 494
            .::|...:...|    :.:.|..::   .:.||.|.|:::
Zfish  1028 RAVLQEFNCFQL----ELRGDVEMKGKGRMRTYWLLGEIS 1063

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXCNP_609593.1 AC_N <33..285 CDD:292831 16/83 (19%)
CYCc 293..468 CDD:214485 48/177 (27%)
Nucleotidyl_cyc_III 307..466 CDD:299850 48/161 (30%)
CYCc 833..1060 CDD:214485
Nucleotidyl_cyc_III 861..1085 CDD:299850
npr1aNP_001038402.1 PBP1_NPR_A 48..449 CDD:107380
ANF_receptor 66..421 CDD:279440
PK_GC-A_B 540..814 CDD:270944 5/22 (23%)
TyrKc 554..808 CDD:197581 3/15 (20%)
HNOBA <823..868 CDD:285003 9/44 (20%)
CYCc 847..1032 CDD:214485 55/207 (27%)
Guanylate_cyc 874..1060 CDD:278633 55/209 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.