Sequence 1: | NP_609593.1 | Gene: | ACXC / 34689 | FlyBaseID: | FBgn0040508 | Length: | 1130 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_685297.5 | Gene: | gucy1b2 / 557191 | ZFINID: | ZDB-GENE-130530-664 | Length: | 757 | Species: | Danio rerio |
Alignment Length: | 198 | Identity: | 56/198 - (28%) |
---|---|---|---|
Similarity: | 98/198 - (49%) | Gaps: | 24/198 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 265 LLDSILPPQIAKPVQEKIKSKITQSENSPDRFQMGPRTTESFMAIQIHPDVSILYADVVNYTHLT 329
Fly 330 TTLTVGNLVKVLHDLYGRFDIAASNFKVQRIKFLGDCYYCVAGLTTPDPDHAKCCVSLGISMISN 394
Fly 395 IQEV-RAERGLDIDMRIGVHSGSLLAGIIGEAKLQFDIWGTDVEIANHLESTGEPGYVHVSGRTL 458
Fly 459 SML 461 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ACXC | NP_609593.1 | AC_N | <33..285 | CDD:292831 | 6/19 (32%) |
CYCc | 293..468 | CDD:214485 | 50/170 (29%) | ||
Nucleotidyl_cyc_III | 307..466 | CDD:299850 | 48/156 (31%) | ||
CYCc | 833..1060 | CDD:214485 | |||
Nucleotidyl_cyc_III | 861..1085 | CDD:299850 | |||
gucy1b2 | XP_685297.5 | HNOB | 2..163 | CDD:285002 | |
CAF-1_p150 | <166..277 | CDD:288454 | |||
HNOBA | 269..453 | CDD:285003 | 5/12 (42%) | ||
CYCc | 432..618 | CDD:214485 | 56/198 (28%) | ||
Guanylate_cyc | 459..642 | CDD:278633 | 48/161 (30%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2114 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |