DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXC and gucy1b2

DIOPT Version :9

Sequence 1:NP_609593.1 Gene:ACXC / 34689 FlyBaseID:FBgn0040508 Length:1130 Species:Drosophila melanogaster
Sequence 2:XP_685297.5 Gene:gucy1b2 / 557191 ZFINID:ZDB-GENE-130530-664 Length:757 Species:Danio rerio


Alignment Length:198 Identity:56/198 - (28%)
Similarity:98/198 - (49%) Gaps:24/198 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 LLDSILPPQIAKPVQEKIKSKITQSENSPDRFQMGPRTTESFMAIQIHPDVSILYADVVNYTHLT 329
            ||.::||..:|..::|                  |.|.......:     .:||::|||.:|::.
Zfish   440 LLYAMLPTHVANQLKE------------------GKRVEAGEFKV-----CTILFSDVVTFTNIC 481

  Fly   330 TTLTVGNLVKVLHDLYGRFDIAASNFKVQRIKFLGDCYYCVAGLTTPDPDHAKCCVSLGISMISN 394
            .......:|.:|:.:|.|||...|...|.:::.:||.|..|.|:..|...||:...:..:.|...
Zfish   482 AACEPIQIVNMLNAMYSRFDRLTSIHNVYKVETIGDAYMVVGGVPVPTNTHAERVANFALGMRIA 546

  Fly   395 IQEV-RAERGLDIDMRIGVHSGSLLAGIIGEAKLQFDIWGTDVEIANHLESTGEPGYVHVSGRTL 458
            .:|| ....|..|.:|:|:|:|.:|||::||...::.::|..|..|:.:||.|.|.::|||..|.
Zfish   547 AREVTNPITGQPIQIRVGLHTGPVLAGVVGEKMPRYCLFGDTVNTASRMESHGVPDHIHVSPFTF 611

  Fly   459 SML 461
            |::
Zfish   612 SVI 614

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXCNP_609593.1 AC_N <33..285 CDD:292831 6/19 (32%)
CYCc 293..468 CDD:214485 50/170 (29%)
Nucleotidyl_cyc_III 307..466 CDD:299850 48/156 (31%)
CYCc 833..1060 CDD:214485
Nucleotidyl_cyc_III 861..1085 CDD:299850
gucy1b2XP_685297.5 HNOB 2..163 CDD:285002
CAF-1_p150 <166..277 CDD:288454
HNOBA 269..453 CDD:285003 5/12 (42%)
CYCc 432..618 CDD:214485 56/198 (28%)
Guanylate_cyc 459..642 CDD:278633 48/161 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.