DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXC and Gycalpha99B

DIOPT Version :9

Sequence 1:NP_609593.1 Gene:ACXC / 34689 FlyBaseID:FBgn0040508 Length:1130 Species:Drosophila melanogaster
Sequence 2:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster


Alignment Length:453 Identity:101/453 - (22%)
Similarity:169/453 - (37%) Gaps:108/453 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 LTVLSINFCEKFVSRHRWVMIASSVLSVYLVVLTDIVMISYHFYKNDWPLNTSFDVFTLCMIYMF 168
            |.:.|.:||:.|    .|..|.:..|        ::|.:...|.|...|....|.    |....:
  Fly   259 LQMNSSSFCKMF----PWHFIMNEQL--------ELVQLGRGFSKLYKPYMADFG----CQATTY 307

  Fly   169 LPIPSIKGAAL-LASSVSLIYVAFFMHSLTFNAVYTDRDSFGYDV---------------ISTDI 217
            ......||..: ....|...|..|.: .|.......|..:.|.::               |.:..
  Fly   308 FDFKRPKGLTMKFRDIVRRTYTPFLI-GLNNPPGAVDFPAIGLEIKGQMVHCPESNSLLFIGSPF 371

  Fly   218 LHNL-GFNMMGIFFR-----------IMNDTMVRAS-----FLDRHQFIMEETWLRHALLQES-- 263
            |..| |....|:|..           |:.....||.     .:|:.:..:||.  ..|:.:|.  
  Fly   372 LDGLDGLTCNGLFISDIPLHDATREVILVGEQARAQDGLRRRMDKIKNSIEEA--NSAVTKERKK 434

  Fly   264 --ILLDSILPPQIAKPVQEKIKSKITQSENSPDRFQMGPRTTESFMAIQIHPDVSILYADVVNYT 326
              .||..|.|.:||                  ::..:|     |.:..:.:|||:||::|:|.:|
  Fly   435 NVSLLHLIFPAEIA------------------EKLWLG-----SSIDAKTYPDVTILFSDIVGFT 476

  Fly   327 HLTTTLTVGNLVKVLHDLYGRFDIAASNFKVQRIKFLGDCYYCVAGLTTPDPDHAKCCVSLGISM 391
            .:.:..|...::.:|..||..||.....|.|.:::.:||.|...:||.......|.....:.:.|
  Fly   477 SICSRATPFMVISMLEGLYKDFDEFCDFFDVYKVETIGDAYCVASGLHRASIYDAHKVAWMALKM 541

  Fly   392 ISNIQEVRAERGLDIDMRIGVHSGSLLAGIIGEAKLQFDIWGTDVEIANHLESTGEPGYVHVSGR 456
            |....:.....|..|.||||:|:|::|||::|....::.::|..|.|||..||..|...::||..
  Fly   542 IDACSKHITHDGEQIKMRIGLHTGTVLAGVVGRKMPRYCLFGHSVTIANKFESGSEALKINVSPT 606

  Fly   457 TLSM----------LNPADYTIL-------SGTQKA-----------QSD-PVLQYIHTYLLT 490
            |...          |.|.|.:.|       .||:..           .|: |::::|:..:.|
  Fly   607 TKDWLTKHEGFEFELQPRDPSFLPKEFPNPGGTETCYFLESFRNPALDSELPLVEHINVSMKT 669

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXCNP_609593.1 AC_N <33..285 CDD:292831 42/217 (19%)
CYCc 293..468 CDD:214485 52/184 (28%)
Nucleotidyl_cyc_III 307..466 CDD:299850 49/168 (29%)
CYCc 833..1060 CDD:214485
Nucleotidyl_cyc_III 861..1085 CDD:299850
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002
HNOBA 259..451 CDD:285003 42/228 (18%)
CYCc 430..619 CDD:214485 56/211 (27%)
Guanylate_cyc 457..647 CDD:278633 53/189 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453982
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.