DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXC and Gyc89Da

DIOPT Version :9

Sequence 1:NP_609593.1 Gene:ACXC / 34689 FlyBaseID:FBgn0040508 Length:1130 Species:Drosophila melanogaster
Sequence 2:NP_001036718.1 Gene:Gyc89Da / 42001 FlyBaseID:FBgn0038435 Length:667 Species:Drosophila melanogaster


Alignment Length:296 Identity:75/296 - (25%)
Similarity:125/296 - (42%) Gaps:68/296 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   795 CMMLLTMYAKERQSEFNTKMNYKLNVDLQNKQKAADLTNQSIIILLNNILPSHVVDLYLNSLAKH 859
            |..|..|:.||.|.          :.:|:...:.||...:....||.:::|..:.:   ......
  Fly   429 CSKLEIMFEKEEQR----------SDELEKSLELADSWKRQGDELLYSMIPRPIAE---RMRLSE 480

  Fly   860 ELYYENYRMVSVMFAMLIN-FPMNLPSLRVLNDIITQFDRLLTAYREYYV---VEKIKVVGCTYM 920
            |...:::..|||:|..::| :...|.|::.....:...:::.:|..|..:   |.|::.||..||
  Fly   481 EQVCQSFEEVSVIFLEVMNVYDEGLNSIQGAMQTVNTLNKVFSALDEEIISPFVYKVETVGMVYM 545

  Fly   921 AACGL-DFNLASNIRQTDHFRNSSLHVEVEHARNHRMTDENYDSDMNNDEVVFIMTTFALDLMRT 984
            |..|. |.|              .||  .|||                       ...||.:|: 
  Fly   546 AVSGAPDVN--------------PLH--AEHA-----------------------CDLALRVMK- 570

  Fly   985 LAACNRAYSSSFFERSLSQGKICIGISSGEIMAGVVGASQPHYDIWGNPVNMASRMESTGLPGHI 1049
                      .|....:....|.:||:||.::|||||...|.|.::|:.||.||||||:..|..|
  Fly   571 ----------KFKAHDMGDVAIRVGINSGPVVAGVVGQKVPRYCLFGDTVNTASRMESSSDPWKI 625

  Fly  1050 QVTEESAKILQEFDIKCIYRGMTFVKGRGDIPTYFV 1085
            |:::.:...:::...|...||...|||:||:.||::
  Fly   626 QLSKYTGDKVRQVGYKVESRGTVQVKGKGDMETYWL 661

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXCNP_609593.1 AC_N <33..285 CDD:292831
CYCc 293..468 CDD:214485
Nucleotidyl_cyc_III 307..466 CDD:299850
CYCc 833..1060 CDD:214485 56/231 (24%)
Nucleotidyl_cyc_III 861..1085 CDD:299850 62/228 (27%)
Gyc89DaNP_001036718.1 HNOB 2..161 CDD:285002
HNOBA 218..476 CDD:285003 12/59 (20%)
CYCc 457..643 CDD:214485 57/238 (24%)
Guanylate_cyc 485..662 CDD:278633 62/227 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453992
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.