DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXC and CG33958

DIOPT Version :9

Sequence 1:NP_609593.1 Gene:ACXC / 34689 FlyBaseID:FBgn0040508 Length:1130 Species:Drosophila melanogaster
Sequence 2:NP_001033958.1 Gene:CG33958 / 37088 FlyBaseID:FBgn0053958 Length:710 Species:Drosophila melanogaster


Alignment Length:286 Identity:80/286 - (27%)
Similarity:123/286 - (43%) Gaps:77/286 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   816 YKLNVDLQNKQKAADLTNQ---SIIILLNNILPSHVVDLYLNSLAKHELYYENYRMVSVMFAMLI 877
            |.||:    .|||.:|..:   |..:|...:.||..:.|........||    |..|::.|:.::
  Fly   445 YALNL----SQKAKELKREKRKSDSLLFQMLPPSVAMQLKQTQQVPAEL----YEAVTIYFSDIV 501

  Fly   878 NF--------PMNLPSLRVLNDIITQFDRLLTAYREYYVVEKIKVVGCTYMAACGLDFNLASNIR 934
            .|        |:.:  :..||.|...||..:    |.|.|.|::.:|.:||.|.||.        
  Fly   502 GFTEIAADCTPLEV--VTFLNSIYRVFDERI----ECYDVYKVETIGDSYMVASGLP-------- 552

  Fly   935 QTDHFRNSSLHVEVEHARNHRMTDENYDSDMNNDEVVFIMTTFALDLMRTLAACNRAYSSSFFER 999
                .:|.:.|:..                         :.|.||||:.         :||.| |
  Fly   553 ----VKNGNKHISE-------------------------IATMALDLLD---------ASSVF-R 578

  Fly  1000 SLSQG----KICIGISSGEIMAGVVGASQPHYDIWGNPVNMASRMESTGLPGHIQVTEESAKILQ 1060
            ....|    :|..|:.:|.::||:||...|.|.::|:.||.||||||||....|.:|||....||
  Fly   579 IPRAGDEFVQIRCGVHTGPVVAGIVGTKMPRYCLFGDTVNTASRMESTGEAQKIHITEEMHDSLQ 643

  Fly  1061 EF-DIKCIYRGMTFVKGRGDIPTYFV 1085
            :. ..:..:||:..|||:|.:.||::
  Fly   644 QVGGFRTEHRGLIDVKGKGLMSTYWL 669

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXCNP_609593.1 AC_N <33..285 CDD:292831
CYCc 293..468 CDD:214485
Nucleotidyl_cyc_III 307..466 CDD:299850
CYCc 833..1060 CDD:214485 63/241 (26%)
Nucleotidyl_cyc_III 861..1085 CDD:299850 67/236 (28%)
CG33958NP_001033958.1 NIT 159..396 CDD:285564
HNOBA <439..479 CDD:285003 11/37 (30%)
CYCc 459..647 CDD:214485 65/244 (27%)
Guanylate_cyc 485..669 CDD:278633 68/240 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.