DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXC and Phlpp

DIOPT Version :9

Sequence 1:NP_609593.1 Gene:ACXC / 34689 FlyBaseID:FBgn0040508 Length:1130 Species:Drosophila melanogaster
Sequence 2:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster


Alignment Length:435 Identity:91/435 - (20%)
Similarity:139/435 - (31%) Gaps:131/435 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   787 ELAHCLRVCMMLLTMYAKERQSEFNTKMNYKLNVDLQNKQKAADLTNQSIIILLNNI--LPSHV- 848
            |...|.|..:|.|.:.....|: .....||..|:...|.. ...|..|.|.|..||.  ||:.| 
  Fly    92 ETLKCSRNKLMELIINGTNLQT-LVADHNYLHNISTTNTH-PVPLKLQRIDISHNNFSELPNWVG 154

  Fly   849 -------VDLYLNSLAKHELYYENYR---MVSVMFA-----MLINFPMNLPSLRVLNDIITQFDR 898
                   ::...|.|....:...|||   :||:..|     .|..||....|:|.|.   .|.:.
  Fly   155 ACASLTAINASHNRLNNVAVLLRNYRITELVSLDLAYNDLKQLDQFPEGFSSIRSLQ---LQSNE 216

  Fly   899 LLTAYREYYVVEKIKV----VGCTYMA----------ACGLDFNLASNIRQTDHFRNSSLHVEVE 949
            |.:....::.|...::    |.|..::          |..::.:||.|     |. |.|:...:.
  Fly   217 LPSLPDNFFAVTHARLETLNVSCNKLSTLPRYEQNNHAALVNLSLAGN-----HL-NDSIFEPLH 275

  Fly   950 HARNHRMTDENYD--------SDMNNDEVVFIMTT-----------FALDLMRTLAACNRAYSSS 995
            :|...|:....|:        ...|..|:..::.:           ..|..:|.|..||...   
  Fly   276 NAAKLRVLHLAYNRIGVLPAACVRNWPELEILVLSGNMLQQLPEEVATLGQLRVLRCCNNLL--- 337

  Fly   996 FFERSLSQGKICIGISSGEIMAGVVGASQPHYDIWGNPVNMASRMESTG-----LPGH--IQVTE 1053
                      :|....:...|..|:..|..|.|    .||:.:.:.|..     |.|:  :||.|
  Fly   338 ----------LCTPQLAKLAMLKVLDLSHNHLD----RVNLLALVPSRNLKYLDLSGNLQLQVDE 388

  Fly  1054 ESAKILQE--------FDIKCIYR--------------------------GMTFVKGRGD---IP 1081
            :..|:.|.        .|:....|                          |.....|.||   :.
  Fly   389 QQFKVCQSQSQRHWSLVDVSGNNRAALPTTKIRQVSAQRNQNKTSGPWTMGFAETPGSGDCRKLS 453

  Fly  1082 TY------FVGIDENLKFMSAKLVNRSLSRRFSVMSSLDPDSLRK 1120
            .|      :.|.||.|..|...|..|  .|....||.|.||.:::
  Fly   454 VYQLRAANYGGSDEALYGMFEALEGR--GRAAQEMSHLVPDLMKQ 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXCNP_609593.1 AC_N <33..285 CDD:292831
CYCc 293..468 CDD:214485
Nucleotidyl_cyc_III 307..466 CDD:299850
CYCc 833..1060 CDD:214485 59/284 (21%)
Nucleotidyl_cyc_III 861..1085 CDD:299850 57/314 (18%)
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 5/17 (29%)
LRR_8 109..169 CDD:290566 15/61 (25%)
leucine-rich repeat 111..135 CDD:275380 5/25 (20%)
leucine-rich repeat 136..158 CDD:275380 8/21 (38%)
leucine-rich repeat 159..183 CDD:275380 5/23 (22%)
leucine-rich repeat 184..209 CDD:275380 7/24 (29%)
LRR_8 205..266 CDD:290566 12/68 (18%)
leucine-rich repeat 210..230 CDD:275380 4/22 (18%)
leucine-rich repeat 232..255 CDD:275380 2/22 (9%)
LRR_RI <256..410 CDD:238064 33/176 (19%)
leucine-rich repeat 256..276 CDD:275380 6/25 (24%)
LRR_8 279..359 CDD:290566 13/92 (14%)
leucine-rich repeat 280..303 CDD:275380 3/22 (14%)
leucine-rich repeat 304..348 CDD:275380 6/56 (11%)
leucine-rich repeat 349..372 CDD:275380 7/26 (27%)
PP2Cc 461..655 CDD:294085 13/38 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.