DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXC and GUCY1B1

DIOPT Version :9

Sequence 1:NP_609593.1 Gene:ACXC / 34689 FlyBaseID:FBgn0040508 Length:1130 Species:Drosophila melanogaster
Sequence 2:XP_011530203.1 Gene:GUCY1B1 / 2983 HGNCID:4687 Length:662 Species:Homo sapiens


Alignment Length:228 Identity:59/228 - (25%)
Similarity:104/228 - (45%) Gaps:41/228 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 LLDSILPPQIAKPVQEKIKSKITQSENSPDRFQMGPRTTESFMAIQIHPDVSILYADVVNYTHLT 329
            ||.|:|||.:|..::.|......:.:|                       |:||::.:|.:....
Human   436 LLYSVLPPSVANEL
RHKRPVPAKRYDN-----------------------VTILFSGIVGFNAFC 477

  Fly   330 TTLTVG----NLVKVLHDLYGRFDIAASNFK---VQRIKFLGDCYYCVAGLTTPDPDHAKCCVSL 387
            :....|    .:|.:|:|||.|||....:.|   |.:::.:||.|..|:||..|...||:....|
Human   478 SKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEPCIHHARSICHL 542

  Fly   388 GISMISNIQEVRAERGLDIDMRIGVHSGSLLAGIIGEAKLQFDIWGTDVEIANHLESTGEPGYVH 452
            .:.|:....:|:.: |..:.:.||:|:|.::.|:||:...::.::|..|.:.:..|:|||.|.::
Human   543 ALDMMEIAGQVQVD-GESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKIN 606

  Fly   453 VSGRTLSMLNPADYTILSGTQKAQSDPVLQYIH 485
            ||          :||.........|||.....|
Human   607 VS----------EYTYRCLMSPENSDPQFHLEH 629

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXCNP_609593.1 AC_N <33..285 CDD:292831 8/19 (42%)
CYCc 293..468 CDD:214485 45/181 (25%)
Nucleotidyl_cyc_III 307..466 CDD:299850 44/165 (27%)
CYCc 833..1060 CDD:214485
Nucleotidyl_cyc_III 861..1085 CDD:299850
GUCY1B1XP_011530203.1 HNOB 2..166 CDD:311572
HNOBA 207..449 CDD:311573 7/12 (58%)
Guanylate_cyc 455..648 CDD:306677 51/209 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.