DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXC and GUCY1A1

DIOPT Version :9

Sequence 1:NP_609593.1 Gene:ACXC / 34689 FlyBaseID:FBgn0040508 Length:1130 Species:Drosophila melanogaster
Sequence 2:NP_000847.2 Gene:GUCY1A1 / 2982 HGNCID:4685 Length:690 Species:Homo sapiens


Alignment Length:480 Identity:97/480 - (20%)
Similarity:197/480 - (41%) Gaps:109/480 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 FLTIELLYVQHYNAVFFNFVIRVVSTILVLTVLSI--------NFCEKFVSRHRWV--------- 122
            ||.:...:.:...::....:|:..:.:|..|.:.:        |.|.:||::...:         
Human   199 FLHVYYFFPKRTTSLILPGIIKAAAHVLYETEVEVSLMPPCFHNDCSEFVNQPYLLYSVHMKSTK 263

  Fly   123 -MIASSVLSVYLVVLTDIVMISYHFY---------------------KNDWPLNTSFDVF----- 160
             .::.|.....||:.|.:...::.|:                     :.|:....:|:.:     
Human   264 PSLSPSKPQSSLVIPTSLFCKTFPFHFMFDKDMTILQFGNGIRRLMNRRDFQGKPNFEEYFEILT 328

  Fly   161 -----TLCMIYMFLPIPSI-----------KGAALLASSVSLIYVAFFMHSLTFNAVYTDR--DS 207
                 |...|...|.:..:           |.:.::.....:||:......|...:...||  |.
Human   329 PKINQTFSGIMTMLNMQFVVRVRRWDNSVKKSSRVMDLKGQMIYIVESSAILFLGSPCVDRLEDF 393

  Fly   208 FGYDVISTDI-LHNLGFNMM----------GIFFRIMNDTMVRASFLDRHQFIMEETWLRHALLQ 261
            .|..:..:|| :||...:::          |:..|:   ..::|:....||.:.||.       :
Human   394 TGRGLYLSDIPIHNALRDVVLIGEQARAQDGLKKRL---GKLKATLEQAHQALEEEK-------K 448

  Fly   262 ESI-LLDSILPPQIAKPVQEKIKSKITQSENSPDRFQMGPRTTESFMAIQIHPDVSILYADVVNY 325
            ::: ||.||.|.::|   |:..:.::.|::    :|.                :|::|::|:|.:
Human   449 KTVDLLCSIFPCEVA---QQLWQGQVVQAK----KFS----------------NVTMLFSDIVGF 490

  Fly   326 THLTTTLTVGNLVKVLHDLYGRFDIAASNFKVQRIKFLGDCYYCVAGLTTPDPD-HAKCCVSLGI 389
            |.:.:..:...::.:|:.||.|||.......|.:::.:||. |||||....:.| ||.....:.:
Human   491 TAICSQCSPLQVITMLNALYTRFDQQCGELDVYKVETIGDA-YCVAGGLHKESDTHAVQIALMAL 554

  Fly   390 SMISNIQEVRAERGLDIDMRIGVHSGSLLAGIIGEAKLQFDIWGTDVEIANHLESTGEPGYVHVS 454
            .|:....||.:..|..|.||||:||||:.||::|....::.::|.:|.:||..||...|..::||
Human   555 KMMELSDEVMSPHGEPIKMRIGLHSGSVFAGVVGVKMPRYCLFGNNVTLANKFESCSVPRKINVS 619

  Fly   455 GRTLSMLNPADYTILSGTQKAQSDP 479
            ..|..:|......:.:...:.:..|
Human   620 PTTYRLLKDCPGFVFTPRSREELPP 644

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXCNP_609593.1 AC_N <33..285 CDD:292831 45/283 (16%)
CYCc 293..468 CDD:214485 50/175 (29%)
Nucleotidyl_cyc_III 307..466 CDD:299850 49/159 (31%)
CYCc 833..1060 CDD:214485
Nucleotidyl_cyc_III 861..1085 CDD:299850
GUCY1A1NP_000847.2 HNOBA 277..466 CDD:400168 33/201 (16%)
Guanylate_cyc 472..643 CDD:306677 51/191 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.