DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXC and gcy-21

DIOPT Version :9

Sequence 1:NP_609593.1 Gene:ACXC / 34689 FlyBaseID:FBgn0040508 Length:1130 Species:Drosophila melanogaster
Sequence 2:NP_001364740.1 Gene:gcy-21 / 191651 WormBaseID:WBGene00001546 Length:1163 Species:Caenorhabditis elegans


Alignment Length:310 Identity:83/310 - (26%)
Similarity:131/310 - (42%) Gaps:82/310 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   813 KMNYKLNVDLQNKQKAADLTNQSIIILLNNILPSHVVD-LYLNSLAKHELYYENYRMVSVMFAML 876
            |...||..|:..:.:..:........||..:||..|.| |.|.|    .:..|::...:|.|:..
 Worm   899 KYTDKLEKDIAERNEELEGEKAKSEALLKMMLPEVVADSLKLGS----NVSAESFENCTVFFSDC 959

  Fly   877 INF--------PMNLPSLRVLNDIITQFDRLLTAYREYYVVEKIKVVGCTYMAACGLDFNLASNI 933
            ..|        |:::  ::.|||:.|.|||::..:..|    |::.:...||.|.||.      :
 Worm   960 PGFVEMSATSKPIDI--VQFLNDLYTVFDRIIDQFDVY----KVETIADAYMVASGLP------V 1012

  Fly   934 RQTDHFRNSSLHVEVEHARNHRMTDENYDSDMNNDEVVFIMTTFALDLMRTLAACNRAYSSSFFE 998
            ...:|           ||..                    :.:..|.|::.:        .||..
 Worm  1013 PNGNH-----------HAGE--------------------IASLGLALLKAV--------ESFKI 1038

  Fly   999 RSLSQGKI--CIGISSGEIMAGVVGASQPHYDIWGNPVNMASRMESTGLPGHIQVTEESAKILQE 1061
            |.|...|:  .||::||..:|||||...|.|.::|:.||.||||||.|:|..|..:..:.:||.:
 Worm  1039 RHLPNEKVRLRIGMNSGPCVAGVVGLKMPRYCLFGDTVNTASRMESNGIPLRINCSGTAKEILDQ 1103

  Fly  1062 ---FDIKCIYRGMTFVKGRGDIPTYFVG-----------IDENLKFMSAK 1097
               ::|:  .||:..:||:|...||||.           |.|.:||.|.|
 Worm  1104 LGGYEIE--ERGIVEMKGKGKQMTYFVRGENSDMRRERIIRERVKFASLK 1151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXCNP_609593.1 AC_N <33..285 CDD:292831
CYCc 293..468 CDD:214485
Nucleotidyl_cyc_III 307..466 CDD:299850
CYCc 833..1060 CDD:214485 62/237 (26%)
Nucleotidyl_cyc_III 861..1085 CDD:299850 62/236 (26%)
gcy-21NP_001364740.1 Periplasmic_Binding_Protein_type1 58..422 CDD:415822
PK_GC 612..881 CDD:270894
HNOBA <890..938 CDD:400168 10/38 (26%)
Guanylate_cyc 944..1130 CDD:306677 64/238 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.