DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXC and gcy-13

DIOPT Version :9

Sequence 1:NP_609593.1 Gene:ACXC / 34689 FlyBaseID:FBgn0040508 Length:1130 Species:Drosophila melanogaster
Sequence 2:NP_506097.3 Gene:gcy-13 / 191646 WormBaseID:WBGene00001539 Length:1028 Species:Caenorhabditis elegans


Alignment Length:282 Identity:78/282 - (27%)
Similarity:134/282 - (47%) Gaps:52/282 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 NMMGIFFRIMNDTMVRASFL-DRHQFIMEETWLRHALLQE----SILLDSILPPQIAKPVQEKIK 283
            |:|...|.::..   .||.| |..|..|:|      |::|    .|||..:||.|:|:      :
 Worm   779 NLMDHVFSVLEK---HASSLEDEVQERMKE------LVEEKKKSDILLYRMLPQQVAE------R 828

  Fly   284 SKITQSENSPDRFQMGPRTTESFMAIQIHPDVSILYADVVNYTHLTTTLTVGNLVKVLHDLYGRF 348
            .|:.||. .|:.|:                .|:|.::|||.:|.|....|...:|.:|:|||..|
 Worm   829 LKLGQSV-EPEAFE----------------SVTIFFSDVVGFTVLANKSTPLQVVNLLNDLYTTF 876

  Fly   349 DIAASNFKVQRIKFLGDCYYCVAGLTTPD-PDHAKCCVSLGISMISNIQEVR-----AERGLDID 407
            |.........:::.:||.|..|:||...: .:|.....::.:.::.::|..:     .|:   :.
 Worm   877 DAIIEKNDSYKVETIGDAYLVVSGLPRRNGTEHVANIANMSLELMDSLQAFKIPHLPQEK---VQ 938

  Fly   408 MRIGVHSGSLLAGIIGEAKLQFDIWGTDVEIANHLESTGEPGYVHVSGRTLSMLNP--ADYTILS 470
            :|||:||||.:||::|....::.::|..|..|:.:||.|:||::|:|.....:|..  .:|...|
 Worm   939 IRIGMHSGSCVAGVVGLTMPRYCLFGDTVNTASRMESNGKPGFIHLSSDCYDLLTSLYKEYNTES 1003

  Fly   471 -GTQKAQSDPVLQYIHTYLLTG 491
             |....:...|:|   ||.|.|
 Worm  1004 RGEVIIKGKGVMQ---TYWLLG 1022

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXCNP_609593.1 AC_N <33..285 CDD:292831 19/65 (29%)
CYCc 293..468 CDD:214485 48/182 (26%)
Nucleotidyl_cyc_III 307..466 CDD:299850 45/166 (27%)
CYCc 833..1060 CDD:214485
Nucleotidyl_cyc_III 861..1085 CDD:299850
gcy-13NP_506097.3 PBP1_NPR_GC_like 3..397 CDD:107347
ANF_receptor 13..368 CDD:279440
PKc_like 548..770 CDD:304357
HNOBA <797..829 CDD:285003 13/43 (30%)
CYCc 808..1000 CDD:214485 58/217 (27%)
Guanylate_cyc 835..1022 CDD:278633 55/209 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.