DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXC and gc2

DIOPT Version :9

Sequence 1:NP_609593.1 Gene:ACXC / 34689 FlyBaseID:FBgn0040508 Length:1130 Species:Drosophila melanogaster
Sequence 2:XP_021333059.1 Gene:gc2 / 140425 ZFINID:ZDB-GENE-011128-8 Length:1120 Species:Danio rerio


Alignment Length:332 Identity:82/332 - (24%)
Similarity:149/332 - (44%) Gaps:77/332 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 DTMVRASFLDRHQFIMEETWLRHALLQESI------------LLDSILPPQIAKPVQEKIKSKIT 287
            |:|:|  .|:::...:||      |::|..            ||..:|||.:|    |.:|...|
Zfish   822 DSMLR--MLEQYSSNLEE------LIRERTEELEIEKQKTEKLLTQMLPPSVA----EALKLGTT 874

  Fly   288 QSENSPDRFQMGPRTTESFMAIQIHPDVSILYADVVNYTHLTTTLTVGNLVKVLHDLYGRFDIAA 352
            .   .|:.|:                .||:.::|:|.:|.::.......:|.:|:|||..||...
Zfish   875 V---EPEHFE----------------SVSLYFSDIVGFTTISANSEPIEVVDLLNDLYTTFDAVI 920

  Fly   353 SNFKVQRIKFLGDCYYCVAGLTTPDPD-HAKCCVSLGISMISNIQEVRAERGLDID--MRIGVHS 414
            .|..|.:::.:||.|...:|:..|:.: ||....::.:.::|.:...|.....|:.  :|||:|:
Zfish   921 GNHDVYKVETIGDAYMVASGVPVPNGNRHAAEIANMALDILSAVGTFRMRHMPDVPVRIRIGLHT 985

  Fly   415 GSLLAGIIGEAKLQFDIWGTDVEIANHLESTGEPGYVHVSGRTLSMLNPADY---------TILS 470
            |..:||::|....::.::|..|..|:.:||||.|..:||...|:.:|.....         |.|.
Zfish   986 GPCVAGVVGLTMPRYCLFGDTVTTASRMESTGLPYRIHVHSSTVKILMELKLGYRVELRARTELK 1050

  Fly   471 GTQKAQSDPVLQYIHTYLLTGQVARESFITSI-------GGVRSS--SVLEVKSIDRIRSSRP-S 525
            |.:..:         ||.|||   |:.|...:       .|:.|.  .|:..|::.:|.:.|. :
Zfish  1051 GKRIEE---------TYWLTG---RDGFTKPLPVPPVLKSGLESKDFKVMLKKAVRKISTVRQVA 1103

  Fly   526 QSSMTDE 532
            |.:::||
Zfish  1104 QLTLSDE 1110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXCNP_609593.1 AC_N <33..285 CDD:292831 16/61 (26%)
CYCc 293..468 CDD:214485 46/186 (25%)
Nucleotidyl_cyc_III 307..466 CDD:299850 44/161 (27%)
CYCc 833..1060 CDD:214485
Nucleotidyl_cyc_III 861..1085 CDD:299850
gc2XP_021333059.1 PBP1_sensory_GC_DEF_like 59..440 CDD:107366
PK_GC-2D 551..815 CDD:270945
HNOBA <824..869 CDD:311573 14/56 (25%)
CYCc 848..1040 CDD:214485 55/214 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.