DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXC and gucy1a2

DIOPT Version :9

Sequence 1:NP_609593.1 Gene:ACXC / 34689 FlyBaseID:FBgn0040508 Length:1130 Species:Drosophila melanogaster
Sequence 2:XP_009290254.2 Gene:gucy1a2 / 100330875 ZFINID:ZDB-GENE-121023-3 Length:608 Species:Danio rerio


Alignment Length:289 Identity:77/289 - (26%)
Similarity:134/289 - (46%) Gaps:56/289 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 LDRHQFIMEETWLRHALLQES-----ILLDSILPPQIAK------PVQEKIKSKITQSENSPDRF 296
            :|:.:..:|:|   |..|:|.     .||.||.|..:|:      |||.|             :|
Zfish   344 MDKLKATLEKT---HQALEEEKRRTVDLLYSIFPGDVAQRLWQGLPVQAK-------------KF 392

  Fly   297 QMGPRTTESFMAIQIHPDVSILYADVVNYTHLTTTLTVGNLVKVLHDLYGRFDIAASNFKVQRIK 361
            .                ||::|::|:|.:|.:....|...::.:|::||.|||.......|.:|:
Zfish   393 D----------------DVTMLFSDIVGFTAVCAQCTPMQVISMLNELYTRFDYQCGILDVYKIE 441

  Fly   362 FLGDCYYCVAGLTTPDPDHAKCCVSLGISMISNIQEVRAERGLDIDMRIGVHSGSLLAGIIGEAK 426
            .:||.|....||......|||....:.:.|:...:||....|..|.:|||:||||:|||::|...
Zfish   442 TIGDAYCVAGGLHRKIDSHAKPIALMALKMMELSEEVLTPDGKPIKLRIGIHSGSVLAGVVGVMM 506

  Fly   427 LQFDIWGTDVEIANHLESTGEPGYVHVSGRTLSML-NPADYTILSGTQKAQSD------PVLQYI 484
            .::.::|.:|.:|:..||...|..::||..|..:| :...:|.:..:::...|      |.:.| 
Zfish   507 PRYCLFGNNVTLASKFESGSHPRCINVSPTTYQLLRDDRSFTFIPRSRQELPDNFPKEIPGICY- 570

  Fly   485 HTYLLTGQVARESFITSIGGVRSSSVLEV 513
              :|..|:....:.:||   .||:.:.:|
Zfish   571 --FLEAGKSQSHASLTS---TRSAPIRKV 594

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXCNP_609593.1 AC_N <33..285 CDD:292831 16/52 (31%)
CYCc 293..468 CDD:214485 50/175 (29%)
Nucleotidyl_cyc_III 307..466 CDD:299850 49/159 (31%)
CYCc 833..1060 CDD:214485
Nucleotidyl_cyc_III 861..1085 CDD:299850
gucy1a2XP_009290254.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.