DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXC and gucy1b1

DIOPT Version :9

Sequence 1:NP_609593.1 Gene:ACXC / 34689 FlyBaseID:FBgn0040508 Length:1130 Species:Drosophila melanogaster
Sequence 2:NP_001238874.1 Gene:gucy1b1 / 100150304 ZFINID:ZDB-GENE-090313-160 Length:608 Species:Danio rerio


Alignment Length:418 Identity:99/418 - (23%)
Similarity:169/418 - (40%) Gaps:105/418 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 TDIVMISYHFYKNDWPLNTSFD---VFTLCMIYMFLPIPSIK-GAALLASSVSLI--YVAFFMHS 195
            |....||.:.:...:|.:..||   :.|.|...:|..:|.:: |...|:|..||:  ::.|..|.
Zfish   203 TQETRISPYTFCKAFPFHLMFDKDLMLTQCGNAIFRVLPQLQPGVCNLSSVFSLVRPHIDFSFHG 267

  Fly   196 LT--FNAVYTDRDSFGYDVIST----DILHNLGFNMM-------------GIFF----RIMN-DT 236
            :.  .|.|:..|...|...:.|    |.|.....:.:             .|.|    .:|| |.
Zfish   268 ILSHINTVFVLRSKEGLLNVETAENEDELTGTEISCLRLKGQMISLPETENILFLCSPSVMNLDD 332

  Fly   237 MVR----ASFLDRH-----------QFIMEETWLRHAL------LQESI------------LLDS 268
            :.|    .|.:..|           || .||..|...|      ||.::            ||.|
Zfish   333 LTRRGLYLSDIPLHDATRDLVLLGEQF-REEYKLTQELEILTDRLQHTLRALEDEKKKTDRLLYS 396

  Fly   269 ILPPQIAKPVQEKIKSKITQSENSPDRFQMGPRTTESFMAIQIHPDVSILYADVVNYT-----HL 328
            :|||.:|..::.|......:.:|                       |:||::.:|.:.     |.
Zfish   397 VLPPSVANELRHKRPVPAKRYDN-----------------------VTILFSGIVGFNAFCSKHA 438

  Fly   329 TTTLTVGNLVKVLHDLYGRFDIAASNFK---VQRIKFLGDCYYCVAGLTTPDPDHAKCCVSLGIS 390
            :....: .:|.:|:|:|.||||...:.|   |.:::.:||.|..|:||..|...|||....|.:.
Zfish   439 SAEGAI-KIVNLLNDIYTRFDILTDSRKNPYVYKVETVGDKYMTVSGLPEPCTHHAKSICHLALD 502

  Fly   391 MISNIQEVRAERGLDIDMRIGVHSGSLLAGIIGEAKLQFDIWGTDVEIANHLESTGEPGYVHVSG 455
            |:....:|:.:.. .:.:.||:|:|.::.|:||:...::.::|..|.:.:..|:|||.|.::||.
Zfish   503 MMEIAGQVKVDED-PVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSE 566

  Fly   456 RTLSMLNPADYTILSGTQKAQSDPVLQY 483
            .|        |..|...:.|.....|:|
Zfish   567 YT--------YRCLQSVENADPQFHLEY 586

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXCNP_609593.1 AC_N <33..285 CDD:292831 48/210 (23%)
CYCc 293..468 CDD:214485 46/182 (25%)
Nucleotidyl_cyc_III 307..466 CDD:299850 45/166 (27%)
CYCc 833..1060 CDD:214485
Nucleotidyl_cyc_III 861..1085 CDD:299850
gucy1b1NP_001238874.1 HNOB 2..166 CDD:285002
HNOBA 207..406 CDD:285003 46/199 (23%)
CYCc 385..584 CDD:214485 57/231 (25%)
Guanylate_cyc 412..605 CDD:278633 51/208 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.