DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXC and gucy1a2

DIOPT Version :9

Sequence 1:NP_609593.1 Gene:ACXC / 34689 FlyBaseID:FBgn0040508 Length:1130 Species:Drosophila melanogaster
Sequence 2:NP_001120379.1 Gene:gucy1a2 / 100145454 XenbaseID:XB-GENE-1011801 Length:712 Species:Xenopus tropicalis


Alignment Length:271 Identity:74/271 - (27%)
Similarity:132/271 - (48%) Gaps:37/271 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 LDRHQFIMEETWLRHALLQES-----ILLDSILPPQIAKPVQEKIKSKITQSENSPDRFQMGPRT 302
            :|:.:..:|:|   |..|:|.     .||.||.|..:|:.:.|   .|..|:.    :|.     
 Frog   449 MDKLKATLEKT---HQALEEEKKKTVDLLYSIFPGDVAQQL
WE---GKSVQAR----KFD----- 498

  Fly   303 TESFMAIQIHPDVSILYADVVNYTHLTTTLTVGNLVKVLHDLYGRFDIAASNFKVQRIKFLGDCY 367
                       ||::|::|:|.:|.:....|...::.:|::||.|||.......:.:::.:||.|
 Frog   499 -----------DVTMLFSDIVGFTAVCAQCTPMQVISMLNELYTRFDYQCGFLDIYKVETIGDAY 552

  Fly   368 YCVAGLTTPDPDHAKCCVSLGISMISNIQEVRAERGLDIDMRIGVHSGSLLAGIIGEAKLQFDIW 432
            ...|||......|||....:.:.|:...:||....|..|.||||:||||:|||::|....::.::
 Frog   553 CVAAGLLRQSNSHAKPIALMALKMMELSEEVLTPDGRPIKMRIGIHSGSVLAGVVGVRMPRYCLF 617

  Fly   433 GTDVEIANHLESTGEPGYVHVSGRTLSML-NPADYTILSGTQKAQSDPVLQYIH--TYLL---TG 491
            |.:|.:|:..||...|..::||..|..:| :.|::..:..:::...|...:.|.  .|.|   :|
 Frog   618 GNNVTLASKFESGSHPRRINVSPTTYQLLKDEANFHFVPRSREELPDNFPKEIPGICYFLEADSG 682

  Fly   492 QVARESFITSI 502
            |...:..:||:
 Frog   683 QKQPKPSLTSV 693

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXCNP_609593.1 AC_N <33..285 CDD:292831 13/46 (28%)
CYCc 293..468 CDD:214485 51/175 (29%)
Nucleotidyl_cyc_III 307..466 CDD:299850 50/159 (31%)
CYCc 833..1060 CDD:214485
Nucleotidyl_cyc_III 861..1085 CDD:299850
gucy1a2NP_001120379.1 Pap_E4 30..>86 CDD:367150
HNOB <132..248 CDD:377902
HNOBA 296..486 CDD:369471 12/39 (31%)
Guanylate_cyc 492..679 CDD:306677 56/206 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.