Sequence 1: | NP_001303320.1 | Gene: | kek1 / 34688 | FlyBaseID: | FBgn0015399 | Length: | 880 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021335529.1 | Gene: | lrrc38b / 799882 | ZFINID: | ZDB-GENE-141216-65 | Length: | 291 | Species: | Danio rerio |
Alignment Length: | 215 | Identity: | 60/215 - (27%) |
---|---|---|---|
Similarity: | 89/215 - (41%) | Gaps: | 28/215 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 86 QQSTCQTVCACKWKGGKQTVECIDRHLIQIPEHIDPNTQVLDMSGNKLQTLSNEQFIRANLLNLQ 150
Fly 151 KLYLRNCKIGEIERETFKGLTNLVELDLSHNLLVTVPSLALGHIPSLRELTLASNHIHKIESQAF 215
Fly 216 GNTPSLHKLDLSHCDIQTISAQAFGGLQGLTLLRLNGNKLSELLPKTIETLSRLHGIELHDNPWL 280
Fly 281 CDCRLRDTKLWLMKRNIPYP 300 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
kek1 | NP_001303320.1 | leucine-rich repeat | 103..122 | CDD:275380 | 7/18 (39%) |
LRR_RI | <119..277 | CDD:238064 | 42/157 (27%) | ||
leucine-rich repeat | 123..148 | CDD:275380 | 2/24 (8%) | ||
LRR_8 | 148..207 | CDD:290566 | 21/58 (36%) | ||
leucine-rich repeat | 149..172 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 173..196 | CDD:275380 | 9/22 (41%) | ||
LRR_8 | 195..255 | CDD:290566 | 16/59 (27%) | ||
leucine-rich repeat | 197..220 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 221..244 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 245..268 | CDD:275380 | 8/22 (36%) | ||
LRRCT | 277..327 | CDD:214507 | 8/24 (33%) | ||
IG_like | 338..429 | CDD:214653 | |||
Ig | 346..426 | CDD:143165 | |||
lrrc38b | XP_021335529.1 | LRRNT | 26..56 | CDD:214470 | 10/32 (31%) |
leucine-rich repeat | 36..58 | CDD:275380 | 7/21 (33%) | ||
PLN00113 | <43..>185 | CDD:331614 | 45/166 (27%) | ||
leucine-rich repeat | 59..79 | CDD:275380 | 2/21 (10%) | ||
leucine-rich repeat | 80..103 | CDD:275380 | 8/22 (36%) | ||
LRR_8 | 102..163 | CDD:316378 | 25/83 (30%) | ||
leucine-rich repeat | 104..127 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 128..152 | CDD:275380 | 11/46 (24%) | ||
leucine-rich repeat | 153..176 | CDD:275380 | 8/22 (36%) | ||
TPKR_C2 | 185..235 | CDD:326558 | 8/24 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |