DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek1 and Slitrk1

DIOPT Version :9

Sequence 1:NP_001303320.1 Gene:kek1 / 34688 FlyBaseID:FBgn0015399 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_951020.1 Gene:Slitrk1 / 76965 MGIID:2679446 Length:696 Species:Mus musculus


Alignment Length:319 Identity:73/319 - (22%)
Similarity:122/319 - (38%) Gaps:94/319 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TLLPGMILGTRY--NQLHLYANGGASSSG----PGGY----RPAP-----SSQNEVYSIADSQPM 61
            |..||. |.|.:  |....:|..||..:|    ||.:    :|.|     |::|:          
Mouse   280 TFAPGP-LPTPFKTNGQDEHATPGAVPNGGTKIPGNWQLKIKPTPPIATGSARNK---------- 333

  Fly    62 TEDGYMPPSQHFPPTHSDLDPPAQQQSTCQTVCACKWKGGKQTVECIDRHLIQIPEHIDPNTQVL 126
                        ||.|.         ..|...|:|                    :||..:...:
Mouse   334 ------------PPVHG---------LPCPGGCSC--------------------DHIPGSGLKM 357

  Fly   127 DMSGNKLQTLSNEQFIRANLLNLQKLYLRNCKIGEIERETFKGLTNLVELDLSHNLLVTVPSLAL 191
            :.:...:.:|::   ::..|.|:|:|:||:.||..|.:..|....||:.|||.:|.:..:.:...
Mouse   358 NCNNRNVSSLAD---LKPKLSNVQELFLRDNKIHSIRKSHFVDYKNLILLDLGNNNIANIENNTF 419

  Fly   192 GHIPSLRELTLASNHIHKIESQAFGNTPSLHKLDLSHCDIQTISAQAFGGLQGLTLLRLNGNKLS 256
            .::..||.|.:.||::..:..:.|....:|..|::.:..||.|....|..:..|.:|.||.|.|.
Mouse   420 KNLLDLRWLYMDSNYLDTLSREKFAGLQNLEYLNVEYNAIQLILPGTFNAMPKLRILILNNNLLR 484

  Fly   257 EL----------------------LP--KTIETLSRLHGIELHDNPWLCDCRLRDTKLW 291
            .|                      ||  ..::.|:.:..|:||.|||.|.|.:...|.|
Mouse   485 SLPVDVFAGVSLSKLSLHNNYFMYLPVAGVLDQLTSIIQIDLHGNPWECSCTIVPFKQW 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek1NP_001303320.1 leucine-rich repeat 103..122 CDD:275380 2/18 (11%)
LRR_RI <119..277 CDD:238064 43/181 (24%)
leucine-rich repeat 123..148 CDD:275380 2/24 (8%)
LRR_8 148..207 CDD:290566 20/58 (34%)
leucine-rich repeat 149..172 CDD:275380 8/22 (36%)
leucine-rich repeat 173..196 CDD:275380 5/22 (23%)
LRR_8 195..255 CDD:290566 17/59 (29%)
leucine-rich repeat 197..220 CDD:275380 6/22 (27%)
leucine-rich repeat 221..244 CDD:275380 6/22 (27%)
leucine-rich repeat 245..268 CDD:275380 10/46 (22%)
LRRCT 277..327 CDD:214507 7/15 (47%)
IG_like 338..429 CDD:214653
Ig 346..426 CDD:143165
Slitrk1NP_951020.1 leucine-rich repeat 39..60 CDD:275380
LRR 1 59..80
leucine-rich repeat 62..83 CDD:275380
LRR 2 83..104
leucine-rich repeat 84..107 CDD:275380
LRR 3 106..128
LRR_8 108..166 CDD:290566
leucine-rich repeat 108..131 CDD:275380
LRR 4 131..152
leucine-rich repeat 132..155 CDD:275380
LRR_8 155..213 CDD:290566
LRR 5 155..176
leucine-rich repeat 156..177 CDD:275380
LRR 6 178..199
TPKR_C2 212..>250 CDD:301599
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 268..317 12/37 (32%)
leucine-rich repeat 356..372 CDD:275380 1/18 (6%)
LRR 7 376..397 9/20 (45%)
leucine-rich repeat 377..400 CDD:275380 8/22 (36%)
LRR 8 400..421 6/20 (30%)
leucine-rich repeat 401..424 CDD:275380 5/22 (23%)
LRR 9 424..445 6/20 (30%)
LRR_8 425..483 CDD:290566 17/57 (30%)
leucine-rich repeat 425..448 CDD:275380 6/22 (27%)
LRR 10 448..469 6/20 (30%)
leucine-rich repeat 449..472 CDD:275380 6/22 (27%)
LRR_8 471..530 CDD:290566 13/58 (22%)
LRR 11 472..493 7/20 (35%)
leucine-rich repeat 473..495 CDD:275380 7/21 (33%)
LRR 12 495..516 2/20 (10%)
leucine-rich repeat 496..520 CDD:275380 3/23 (13%)
TPKR_C2 529..579 CDD:301599 7/15 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4837
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.