Sequence 1: | NP_001303320.1 | Gene: | kek1 / 34688 | FlyBaseID: | FBgn0015399 | Length: | 880 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_951020.1 | Gene: | Slitrk1 / 76965 | MGIID: | 2679446 | Length: | 696 | Species: | Mus musculus |
Alignment Length: | 319 | Identity: | 73/319 - (22%) |
---|---|---|---|
Similarity: | 122/319 - (38%) | Gaps: | 94/319 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 TLLPGMILGTRY--NQLHLYANGGASSSG----PGGY----RPAP-----SSQNEVYSIADSQPM 61
Fly 62 TEDGYMPPSQHFPPTHSDLDPPAQQQSTCQTVCACKWKGGKQTVECIDRHLIQIPEHIDPNTQVL 126
Fly 127 DMSGNKLQTLSNEQFIRANLLNLQKLYLRNCKIGEIERETFKGLTNLVELDLSHNLLVTVPSLAL 191
Fly 192 GHIPSLRELTLASNHIHKIESQAFGNTPSLHKLDLSHCDIQTISAQAFGGLQGLTLLRLNGNKLS 256
Fly 257 EL----------------------LP--KTIETLSRLHGIELHDNPWLCDCRLRDTKLW 291 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
kek1 | NP_001303320.1 | leucine-rich repeat | 103..122 | CDD:275380 | 2/18 (11%) |
LRR_RI | <119..277 | CDD:238064 | 43/181 (24%) | ||
leucine-rich repeat | 123..148 | CDD:275380 | 2/24 (8%) | ||
LRR_8 | 148..207 | CDD:290566 | 20/58 (34%) | ||
leucine-rich repeat | 149..172 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 173..196 | CDD:275380 | 5/22 (23%) | ||
LRR_8 | 195..255 | CDD:290566 | 17/59 (29%) | ||
leucine-rich repeat | 197..220 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 221..244 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 245..268 | CDD:275380 | 10/46 (22%) | ||
LRRCT | 277..327 | CDD:214507 | 7/15 (47%) | ||
IG_like | 338..429 | CDD:214653 | |||
Ig | 346..426 | CDD:143165 | |||
Slitrk1 | NP_951020.1 | leucine-rich repeat | 39..60 | CDD:275380 | |
LRR 1 | 59..80 | ||||
leucine-rich repeat | 62..83 | CDD:275380 | |||
LRR 2 | 83..104 | ||||
leucine-rich repeat | 84..107 | CDD:275380 | |||
LRR 3 | 106..128 | ||||
LRR_8 | 108..166 | CDD:290566 | |||
leucine-rich repeat | 108..131 | CDD:275380 | |||
LRR 4 | 131..152 | ||||
leucine-rich repeat | 132..155 | CDD:275380 | |||
LRR_8 | 155..213 | CDD:290566 | |||
LRR 5 | 155..176 | ||||
leucine-rich repeat | 156..177 | CDD:275380 | |||
LRR 6 | 178..199 | ||||
TPKR_C2 | 212..>250 | CDD:301599 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 268..317 | 12/37 (32%) | |||
leucine-rich repeat | 356..372 | CDD:275380 | 1/18 (6%) | ||
LRR 7 | 376..397 | 9/20 (45%) | |||
leucine-rich repeat | 377..400 | CDD:275380 | 8/22 (36%) | ||
LRR 8 | 400..421 | 6/20 (30%) | |||
leucine-rich repeat | 401..424 | CDD:275380 | 5/22 (23%) | ||
LRR 9 | 424..445 | 6/20 (30%) | |||
LRR_8 | 425..483 | CDD:290566 | 17/57 (30%) | ||
leucine-rich repeat | 425..448 | CDD:275380 | 6/22 (27%) | ||
LRR 10 | 448..469 | 6/20 (30%) | |||
leucine-rich repeat | 449..472 | CDD:275380 | 6/22 (27%) | ||
LRR_8 | 471..530 | CDD:290566 | 13/58 (22%) | ||
LRR 11 | 472..493 | 7/20 (35%) | |||
leucine-rich repeat | 473..495 | CDD:275380 | 7/21 (33%) | ||
LRR 12 | 495..516 | 2/20 (10%) | |||
leucine-rich repeat | 496..520 | CDD:275380 | 3/23 (13%) | ||
TPKR_C2 | 529..579 | CDD:301599 | 7/15 (47%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 113 | 1.000 | Inparanoid score | I4837 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.050 |