DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek1 and LRTM2

DIOPT Version :9

Sequence 1:NP_001303320.1 Gene:kek1 / 34688 FlyBaseID:FBgn0015399 Length:880 Species:Drosophila melanogaster
Sequence 2:XP_016875337.1 Gene:LRTM2 / 654429 HGNCID:32443 Length:427 Species:Homo sapiens


Alignment Length:270 Identity:81/270 - (30%)
Similarity:113/270 - (41%) Gaps:59/270 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 TCQTVCACKWKGGKQTVECIDRHLIQIPEHIDPNTQVLDMSGNKLQTLSNEQFIRANLLNLQKLY 153
            ||...|.|..:  ...|:|....|..:|..:...|:.|.:..|||..|.:..|  |||.:||:|.
Human    95 TCPFSCKCDSR--SLEVDCSGLGLTTVPPDVPAATRTLLLLNNKLSALPSWAF--ANLSSLQRLD 155

  Fly   154 LRNCKIGEIERETFKGLTNLVELDLSHNLLVTVPSLALGHIPSLRELTLASNHIHKIESQAFGNT 218
            |.|..:..:.|..|..||||.||.|.:|.:.|:....|.|.|.||.|.|:.|.:.::       .
Human   156 LSNNFLDRLPRSIFGDLTNLTELQLRNNSIRTLDRDLLRHSPLLRHLDLSINGLAQL-------P 213

  Fly   219 PSLHKLDLSHCDIQTISAQAFGGLQGLTLLRLNGNKLSELLPKTIETLSRLHGIELHDNPWLCDC 283
            |.|                 |.||..|..|.|..|:|..|...|.|.|:.|..:::.||||.|||
Human   214 PGL-----------------FDGLLALRSLSLRSNRLQNLDRLTFEPLANLQLLQVGDNPWECDC 261

  Fly   284 RLRDTKLWLMKRNIPYPVAPVCSGGPERIIDRSFADLHVDEFACR-PE--------MLPIS--HY 337
            .||:.|.|:  ....|      .||            .:|:.||. |:        |:|:.  :|
Human   262 NLREFKHWM--EWFSY------RGG------------RLDQLACTLPKELRGKDMRMVPMEMFNY 306

  Fly   338 VEAAMGENAS 347
            ......||:|
Human   307 CSQLEDENSS 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek1NP_001303320.1 leucine-rich repeat 103..122 CDD:275380 4/18 (22%)
LRR_RI <119..277 CDD:238064 49/157 (31%)
leucine-rich repeat 123..148 CDD:275380 10/24 (42%)
LRR_8 148..207 CDD:290566 24/58 (41%)
leucine-rich repeat 149..172 CDD:275380 8/22 (36%)
leucine-rich repeat 173..196 CDD:275380 8/22 (36%)
LRR_8 195..255 CDD:290566 15/59 (25%)
leucine-rich repeat 197..220 CDD:275380 5/22 (23%)
leucine-rich repeat 221..244 CDD:275380 4/22 (18%)
leucine-rich repeat 245..268 CDD:275380 9/22 (41%)
LRRCT 277..327 CDD:214507 14/49 (29%)
IG_like 338..429 CDD:214653 3/10 (30%)
Ig 346..426 CDD:143165 1/2 (50%)
LRTM2XP_016875337.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.